KEGG   Homo sapiens (human): 27072Help
Entry
27072             CDS       T01001                                 

Gene name
VPS41, HVPS41, HVSP41, hVps41p
Definition
(RefSeq) VPS41 subunit of HOPS complex
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
hsa  Homo sapiens (human)
Pathway
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    27072 (VPS41)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27072 (VPS41)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    27072 (VPS41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin ANAPC4_WD40 Vps39_2 Vps39_1 zf-RING_5 zf-RING_2 zf-rbx1 zf-RING_11
Motif
Other DBs
NCBI-GeneID: 27072
NCBI-ProteinID: NP_055211
OMIM: 605485
HGNC: 12713
Ensembl: ENSG00000006715
Vega: OTTHUMG00000023629
Pharos: P49754(Tbio)
UniProt: P49754
Position
7p14.1
AA seq 854 aa AA seqDB search
MAEAEEQETGSLEESTDESEEEESEEEPKLKYERLSNGVTEILQKDAASCMTVHDKFLAL
GTHYGKVYLLDVQGNITQKFDVSPVKINQISLDESGEHMGVCSEDGKVQVFGLYSGEEFH
ETFDCPIKIIAVHPHFVRSSCKQFVTGGKKLLLFERSWMNRWKSAVLHEGEGNIRSVKWR
GHLIAWANNMGVKIFDIISKQRITNVPRDDISLRPDMYPCSLCWKDNVTLIIGWGTSVKV
CSVKERHASEMRDLPSRYVEIVSQFETEFYISGLAPLCDQLVVLSYVKEISEKTEREYCA
RPRLDIIQPLSETCEEISSDALTVRGFQENECRDYHLEYSEGESLFYIVSPRDVVVAKER
DQDDHIDWLLEKKKYEEALMAAEISQKNIKRHKILDIGLAYINHLVERGDYDIAARKCQK
ILGKNAALWEYEVYKFKEIGQLKAISPYLPRGDPVLKPLIYEMILHEFLESDYEGFATLI
REWPGDLYNNSVIVQAVRDHLKKDSQNKTLLKTLAELYTYDKNYGNALEIYLTLRHKDVF
QLIHKHNLFSSIKDKIVLLMDFDSEKAVDMLLDNEDKISIKKVVEELEDRPELQHVYLHK
LFKRDHHKGQRYHEKQISLYAEYDRPNLLPFLRDSTHCPLEKALEICQQRNFVEETVYLL
SRMGNSRSALKMIMEELHDVDKAIEFAKEQDDGELWEDLILYSIDKPPFITGLLNNIGTH
VDPILLIHRIKEGMEIPNLRDSLVKILQDYNLQILLREGCKKILVADSLSLLKKMHRTQM
KGVLVDEENICESCLSPILPSDAAKPFSVVVFHCRHMFHKECLPMPSMNSAAQFCNICSA
KNRGPGSAILEMKK
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcagaggagcaggaaactgggtcccttgaagaatctacagatgagtctgag
gaagaagagagcgaagaggaacccaagctgaagtatgaaaggctttccaatggggtaact
gaaatacttcagaaggatgcagctagctgcatgacagtccatgacaagtttttggcattg
ggcacacattatggcaaggtttatttacttgatgtccaggggaacatcactcagaagttt
gatgtaagtcctgtgaagataaatcagattagcttggatgaaagtggagagcacatgggt
gtgtgttcagaggatggcaaggtgcaggtatttggactgtattctggagaagaatttcac
gagacttttgactgtcccattaaaattattgctgtgcacccacatttcgtgagatccagt
tgcaagcagtttgtgaccggagggaagaagctgctactgtttgaacggtcttggatgaac
agatggaagtctgctgttctgcatgaaggggaagggaacataaggagtgtgaagtggaga
ggccatctgattgcttgggccaataatatgggtgtgaagatttttgacatcatctcaaag
caaagaatcaccaatgtgccccgggatgatataagtcttcgcccagacatgtatccctgc
agcctctgctggaaggacaatgtgacactgattattggctgggggacttctgtcaaggtg
tgctcagtgaaggaacggcatgccagtgaaatgagggatttgccaagtcgatatgttgaa
atagtgtctcagtttgaaactgaattctacatcagtggacttgcacctctctgtgatcag
cttgttgtactttcgtatgtaaaggagatttcagaaaaaacggaaagagaatactgtgcc
aggcctagactggacatcatccagccactttctgagacttgtgaagagatctcttctgat
gctttgacagtcagaggctttcaggagaatgaatgtagagattatcatttagaatactct
gaaggggaatcacttttttacatcgtgagtccgagagatgttgtagtggccaaggaacga
gaccaagatgatcacattgactggctccttgaaaagaagaaatatgaagaagcattgatg
gcagctgaaattagccaaaaaaatattaaaagacataagattctggatattggcttggca
tatataaatcacctggtggagagaggagactatgacatagcagcacgcaaatgccagaaa
attcttgggaaaaatgcagcactctgggaatatgaagtttataaatttaaagaaattgga
cagcttaaggctattagtccttatttgccaagaggtgatccagttctgaaaccactcatc
tatgaaatgatcttacatgaatttttggagagtgattatgagggttttgccacattgatc
cgagaatggcctggagatctgtataataattcagtcatagttcaagcagttcgggatcat
ttgaagaaagatagtcagaacaagactttacttaaaaccctggcagaattgtacacctat
gacaagaactatggcaatgctctggaaatatacttaacattaagacataaagacgttttt
cagttgatccacaagcataatcttttcagttctatcaaggataaaattgttttattaatg
gattttgattcagagaaagctgttgacatgcttttggacaatgaagataaaatttcaatt
aaaaaggtagtggaagaattggaagacagaccagagctacagcatgtgtatttgcataag
cttttcaagagagaccaccataaggggcagcgttaccatgaaaaacagatcagtctttat
gctgaatatgatcgaccaaacttacttccctttctccgagacagtacccattgcccactt
gaaaaggctcttgagatctgtcaacagagaaactttgtagaagagacagtttatcttctg
agccgaatgggtaatagccgaagtgccctgaagatgattatggaggaattacatgatgtt
gataaagcaatcgaatttgccaaggagcaagatgatggagagctgtgggaagatttgatt
ttatattccattgacaaaccaccatttattactggcttgttaaacaacattggcacacat
gttgacccaattctactgattcaccgtattaaggaaggaatggagatccccaatttgaga
gattccttggttaaaattctgcaagactacaatttgcaaattctgcttcgtgaaggctgc
aagaagattctcgtagctgactctttgtccttactgaagaaaatgcaccgaactcaaatg
aaaggtgttcttgttgatgaggagaacatctgtgagtcgtgcctttcccctattcttcca
tcagatgcagctaagcccttcagcgtggtggtcttccattgccggcacatgttccacaag
gagtgcctgcccatgcccagcatgaactctgctgcacagttctgcaacatctgcagtgct
aagaaccgtggaccaggaagtgcaattttggagatgaaaaaatag

DBGET integrated database retrieval system