KEGG   Homo sapiens (human): 27074Help
Entry
27074             CDS       T01001                                 

Gene name
LAMP3, CD208, DC_LAMP, DC-LAMP, DCLAMP, LAMP, LAMP-3, TSC403
Definition
(RefSeq) lysosomal associated membrane protein 3
  KO
K06562  lysosomal-associated membrane protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    27074 (LAMP3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    27074 (LAMP3)
CD molecules [BR:hsa04090]
 Proteins
  27074 (LAMP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lamp ATP-synt_S1
Motif
Other DBs
NCBI-GeneID: 27074
NCBI-ProteinID: NP_055213
OMIM: 605883
HGNC: 14582
Ensembl: ENSG00000078081
Vega: OTTHUMG00000158387
Pharos: Q9UQV4(Tbio)
UniProt: Q9UQV4
Structure
PDB: 

Position
3q27.1
AA seq 416 aa AA seqDB search
MPRQLSAAAALFASLAVILHDGSQMRAKAFPETRDYSQPTAAATVQDIKKPVQQPAKQAP
HQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPV
TEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKST
TGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKA
EMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEES
YYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQL
QAFDFEDDHFGNVDECSSDYTIVLPVIGAIVVGLCLMGMGVYKIRLRCQSSGYQRI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgccccggcagctcagcgcggcggccgcgctcttcgcgtccctggccgtaattttgcac
gatggcagtcaaatgagagcaaaagcatttccagaaaccagagattattctcaacctact
gcagcagcaacagtacaggacataaaaaaacctgtccagcaaccagctaagcaagcacct
caccaaactttagcagcaagattcatggatggtcatatcacctttcaaacagcggccaca
gtaaaaattccaacaactaccccagcgactacaaaaaacactgcaaccaccagcccaatt
acctacaccctggtcacaacccaggccacacccaacaactcacacacagctcctccagtt
actgaagttacagtcggccctagcttagccccttattcactgccacccaccatcacccca
ccagctcatacaactggaaccagttcatcaaccgtcagccacacaactgggaacaccact
caacccagtaaccagaccacccttccagcaactttatcgatagcactgcacaaaagcaca
accggtcagaagcctgttcaacccacccatgccccaggaacaacggcagctgcccacaat
accacccgcacagctgcacctgcctccacggttcctgggcccacccttgcacctcagcca
tcgtcagtcaagactggaatttatcaggttctaaacggaagcagactctgtataaaagca
gagatggggatacagctgattgttcaagacaaggagtcggttttttcacctcggagatac
ttcaacatcgaccccaacgcaacgcaagcctctgggaactgtggcacccgaaaatccaac
cttctgttgaattttcagggcggatttgtgaatctcacatttaccaaggatgaagaatca
tattatatcagtgaagtgggagcctatttgaccgtctcagatccagagacaatttaccaa
ggaatcaaacatgcggtggtgatgttccagacagcagtcgggcattccttcaagtgcgtg
agtgaacagagcctccagttgtcagcccacctgcaggtgaaaacaaccgatgtccaactt
caagcctttgattttgaagatgaccactttggaaatgtggatgagtgctcgtctgactac
acaattgtgcttcctgtgattggggccatcgtggttggtctctgccttatgggtatgggt
gtctataaaatccgcctaaggtgtcaatcatctggataccagagaatctaa

DBGET integrated database retrieval system