KEGG   Homo sapiens (human): 27075
Entry
27075             CDS       T01001                                 

Gene name
TSPAN13, NET-6, NET6, TM4SF13
Definition
(RefSeq) tetraspanin 13
  KO
K17356  tetraspanin-13/31
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    27075 (TSPAN13)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 27075
NCBI-ProteinID: NP_055214
OMIM: 613139
HGNC: 21643
Ensembl: ENSG00000106537
Vega: OTTHUMG00000022968
Pharos: O95857(Tbio)
UniProt: O95857 Q6FGK0
Position
7p21.1
AA seq 204 aa
MVCGGFACSKNCLCALNLLYTLVSLLLIGIAAWGIGFGLISSLRVVGVVIAVGIFLFLIA
LVGLIGAVKHHQVLLFFYMIILLLVFIVQFSVSCACLALNQEQQGQLLEVGWNNTASARN
DIQRNLNCCGFRSVNPNDTCLASCVKSDHSCSPCAPIIGEYAGEVLRFVGGIGLFFSFTE
ILGVWLTYRYRNQKDPRANPSAFL
NT seq 615 nt   +upstreamnt  +downstreamnt
atggtttgcgggggcttcgcgtgttccaagaactgcctgtgcgccctcaacctgctttac
accttggttagtctgctgctaattggaattgctgcgtggggcattggcttcgggctgatt
tccagtctccgagtggtcggcgtggtcattgcagtgggcatcttcttgttcctgattgct
ttagtgggtctgattggagctgtaaaacatcatcaggtgttgctatttttttatatgatt
attctgttacttgtatttattgttcagttttctgtatcttgcgcttgtttagccctgaac
caggagcaacagggtcagcttctggaggttggttggaacaatacggcaagtgctcgaaat
gacatccagagaaatctaaactgctgtgggttccgaagtgttaacccaaatgacacctgt
ctggctagctgtgttaaaagtgaccactcgtgctcgccatgtgctccaatcataggagaa
tatgctggagaggttttgagatttgttggtggcattggcctgttcttcagttttacagag
atcctgggtgtttggctgacctacagatacaggaaccagaaagacccccgcgcgaatcct
agtgcattcctttga

DBGET integrated database retrieval system