KEGG   Homo sapiens (human): 27086Help
Entry
27086             CDS       T01001                                 

Gene name
FOXP1, 12CC4, HSPC215, MFH, QRF1, hFKH1B
Definition
(RefSeq) forkhead box P1
  KO
K23582  forkhead box protein P1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    27086 (FOXP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    27086 (FOXP1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    27086 (FOXP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXP-CC Forkhead Zap1_zf2
Motif
Other DBs
NCBI-GeneID: 27086
NCBI-ProteinID: NP_001231743
OMIM: 605515
HGNC: 3823
Ensembl: ENSG00000114861
Vega: OTTHUMG00000158803
Pharos: Q9H334(Tbio)
UniProt: Q9H334 Q548T7 Q8TEA2
Structure
PDB: 

Position
3p13
AA seq 677 aa AA seqDB search
MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQ
ALQVARQLLLQQQQQQQVSGLKSPKRNDKQPALQVPVSVAMMTPQVITPQQMQQILQQQV
LSPQQLQVLLQQQQALMLQQQQLQEFYKKQQEQLQLQLLQQQHAGKQPKEQQQVATQQLA
FQQQLLQMQQLQQQHLLSLQRQGLLTIQPGQPALPLQPLAQGMIPTELQQLWKEVTSAHT
AEETTGNNHSSLDLTTTCVSSSAPSKTSLIMNPHASTNGQLSVHTPKRESLSHEEHPHSH
PLYGHGVCKWPGCEAVCEDFQSFLKHLNSEHALDDRSTAQCRVQMQVVQQLELQLAKDKE
RLQAMMTHLHVKSTEPKAAPQPLNLVSSVTLSKSASEASPQSLPHTPTTPTAPLTPVTQG
PSVITTTSMHTVGPIRRRYSDKYNVPISSADIAQNQEFYKNAEVRPPFTYASLIRQAILE
SPEKQLTLNEIYNWFTRMFAYFRRNAATWKNAVRHNLSLHKCFVRVENVKGAVWTVDEVE
FQKRRPQKISGNPSLIKNMQSSHAYCTPLNAALQASMAENSIPLYTTASMGNPTLGNLAS
AIREELNGAMEHTNSNESDSSPGRSPMQAVHPVHVKEEPLDPEEAEGPLSLVTTANHSPD
FDHDRDYEDEPVNEDME
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagaatctgggactgagacaaaaagtaacggttcagccatccagaatgggtcg
ggcggcagcaaccacttactagagtgcggcggtcttcgggaggggcggtccaacggagag
acgccggccgtggacatcggggcagctgacctcgcccacgcccagcagcagcagcaacag
gcacttcaggtggcaagacagctccttcttcagcagcaacagcagcagcaagttagtgga
ttaaaatctcccaagaggaatgacaaacaaccagctcttcaggttcccgtgtcagtggct
atgatgacacctcaagttatcactccccagcaaatgcagcagatcctccagcaacaagtg
ctgagccctcagcagctccaggttctcctccagcagcagcaggccctcatgcttcaacag
cagcagcttcaagagttttataaaaaacaacaggaacagttgcagcttcaacttttacaa
caacaacatgctggaaaacagcctaaagagcaacagcaggtggctacccagcagttggct
tttcagcagcagcttttacagatgcagcagttacagcagcagcacctcctgtctttgcag
cgccaaggccttctgacaattcagcccgggcagcctgcccttccccttcaacctcttgct
caaggcatgattccaacagaactgcagcagctctggaaagaagtgacaagtgctcatact
gcagaagaaaccacaggcaacaatcacagcagtttggatctgaccacgacatgtgtctcc
tcctctgcaccttccaagacctccttaataatgaacccacatgcctctaccaatggacag
ctctcagtccacactcccaaaagggaaagtttgtcccatgaggagcacccccatagccat
cctctctatggacatggtgtatgcaagtggccaggctgtgaagcagtgtgcgaagatttc
caatcatttctaaaacatctcaacagtgagcatgcgctggacgatagaagtacagcccaa
tgtagagtacaaatgcaggttgtacagcagttagagctacagcttgcaaaagacaaagaa
cgcctgcaagccatgatgacccacctgcatgtgaagtctacagaacccaaagccgcccct
cagcccttgaatctggtatcaagtgtcactctctccaagtccgcatcggaggcttctcca
cagagcttacctcatactccaacgaccccaaccgcccccctgactcccgtcacccaaggc
ccctctgtcatcacaaccaccagcatgcacacggtgggacccatccgcaggcggtactca
gacaaatacaacgtgcccatttcgtcagcagatattgcgcagaaccaagaattttataag
aacgcagaagttagaccaccatttacatatgcatctttaattaggcaggccattctcgaa
tctccagaaaagcagctaacactaaatgagatctataactggttcacacgaatgtttgct
tacttccgacgcaacgcggccacgtggaagaatgcagtgcgtcataatcttagtcttcac
aagtgttttgtgcgagtagaaaacgttaaaggggcagtatggacagtggatgaagtagaa
ttccaaaaacgaaggccacaaaagatcagtggtaacccttcccttattaaaaacatgcag
agcagccacgcctactgcacacctctcaatgcagctttacaggcttcaatggctgagaat
agtatacctctatacactaccgcttccatgggaaatcccactctgggcaacttagccagc
gcaatacgggaagagctgaacggggcaatggagcataccaacagcaacgagagtgacagc
agtccaggcagatctcctatgcaagccgtgcatcctgtacacgtcaaagaagagcccctc
gatccagaggaagctgaagggcccctgtccttagtgacaacagccaaccacagtccagat
tttgaccatgacagagattacgaagatgaaccagtaaacgaggacatggagtga

DBGET integrated database retrieval system