KEGG   Homo sapiens (human): 27087Help
Entry
27087             CDS       T01001                                 

Gene name
B3GAT1, CD57, GLCATP, GLCUATP, HNK1, LEU7, NK-1, NK1
Definition
(RefSeq) beta-1,3-glucuronyltransferase 1
  KO
K00735  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 [EC:2.4.1.135]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00515  Mannose type O-glycan biosynthesis
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00515 Mannose type O-glycan biosynthesis
    27087 (B3GAT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    27087 (B3GAT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.135  galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase
     27087 (B3GAT1)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   27087 (B3GAT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_43
Motif
Other DBs
NCBI-GeneID: 27087
NCBI-ProteinID: NP_061114
OMIM: 151290
HGNC: 921
Ensembl: ENSG00000109956
Vega: OTTHUMG00000167180
Pharos: Q9P2W7(Tbio)
UniProt: Q9P2W7
Structure
PDB: 

Position
11q25
AA seq 334 aa AA seqDB search
MPKRRDILAIVLIVLPWTLLITVWHQSTLAPLLAVHKDEGSDPRRETPPGADPREYCTSD
RDIVEVVRTEYVYTRPPPWSDTLPTIHVVTPTYSRPVQKAELTRMANTLLHVPNLHWLVV
EDAPRRTPLTARLLRDTGLNYTHLHVETPRNYKLRGDARDPRIPRGTMQRNLALRWLRET
FPRNSSQPGVVYFADDDNTYSLELFEEMRSTRRVSVWPVAFVGGLRYEAPRVNGAGKVVG
WKTVFDPHRPFAIDMAGFAVNLRLILQRSQAYFKLRGVKGGYQESSLLRELVTLNDLEPK
AANCTKILVWHTRTEKPVLVNEGKKGFTDPSVEI
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgccgaagagacgggacatcctagcgatcgtcctcatcgtgctgccctggactctgctc
atcactgtctggcaccagagcaccctcgcacccctgctcgcggtacataaggatgagggc
agtgacccccgacgcgaaacgccgcccggcgccgaccccagggagtactgcacgtctgac
cgcgacatcgtggaggtggtgcgcaccgagtacgtgtacacgcggcccccgccatggtcc
gacacgctgcccaccatccacgtggtgacgcccacctacagccgcccggtgcagaaggcc
gagctgacgcgcatggccaacacgctgctgcacgtgcccaacctccactggctggtggtg
gaggatgcgccgcgccggacgccgctgaccgcgcgcctgctgcgcgacaccggcctcaac
tacacgcacctgcacgtggagacgccccgcaactacaagctgcgcggagacgcccgcgac
ccacgcatcccgcggggcaccatgcagcgcaacctggccctgcgctggctgcgcgagacc
ttcccgcgcaactccagccagcctggcgtggtctacttcgccgacgacgacaacacctac
agcctggagctcttcgaagagatgcgcagcaccaggagggtgtccgtgtggcccgtcgcc
ttcgtgggtggcctgcggtacgaggccccacgggtgaacggggcagggaaggtggtcggc
tggaagacggtgtttgacccccaccggccatttgcaatagacatggctggatttgccgtc
aacctgcggctcattctgcagcgaagccaggcctacttcaagctgcgaggtgtgaaggga
ggctaccaggaaagcagcctccttcgagaacttgtcaccctcaacgacctggagcccaag
gcagccaactgcaccaagatcctggtgtggcacacacggacagagaagccagtgctggtg
aatgagggcaagaagggcttcactgacccctcggtggagatctga

DBGET integrated database retrieval system