KEGG   Homo sapiens (human): 27092Help
Entry
27092             CDS       T01001                                 

Gene name
CACNG4
Definition
(RefSeq) calcium voltage-gated channel auxiliary subunit gamma 4
  KO
K04869  voltage-dependent calcium channel gamma-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04921  Oxytocin signaling pathway
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    27092 (CACNG4)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    27092 (CACNG4)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    27092 (CACNG4)
   04261 Adrenergic signaling in cardiomyocytes
    27092 (CACNG4)
 09160 Human Diseases
  09166 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    27092 (CACNG4)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    27092 (CACNG4)
   05414 Dilated cardiomyopathy (DCM)
    27092 (CACNG4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    27092 (CACNG4)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   27092 (CACNG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 AA_permease_2 DUF2269
Motif
Other DBs
NCBI-GeneID: 27092
NCBI-ProteinID: NP_055220
OMIM: 606404
HGNC: 1408
Ensembl: ENSG00000075461
Vega: OTTHUMG00000179550
Pharos: Q9UBN1(Tdark)
UniProt: Q9UBN1 A0A024R8J8
Position
17q24.2
AA seq 327 aa AA seqDB search
MVRCDRGLQMLLTTAGAFAAFSLMAIAIGTDYWLYSSAHICNGTNLTMDDGPPPRRARGD
LTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSVFPILSTILLLL
GGLCIGAGRIYSRKNNIVLSAGILFVAAGLSNIIGIIVYISSNTGDPSDKRDEDKKNHYN
YGWSFYFGALSFIVAETVGVLAVNIYIEKNKELRFKTKREFLKASSSSPYARMPSYRYRR
RRSRSSSRSTEASPSRDVSPMGLKITGAIPMGELSMYTLSREPLKVTTAASYSPDQEASF
LQVHDFFQQDLKEGFHVSMLNRRTTPV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggtgcgatgcgaccgcgggctgcagatgctgctgaccacggccggagccttcgccgcc
ttctcgctcatggccatcgccatcggcaccgactactggctgtactccagcgcgcacatc
tgcaacggcaccaacctgaccatggacgacgggcccccgccccgccgcgcccgcggcgac
ctcacccactctggtctgtggcgggtgtgctgcatcgaagggatctataaagggcactgc
ttccggatcaatcacttcccagaggacaatgactacgaccacgacagctcggagtacctc
ctccgcatcgtgcgagcctccagcgtcttccccatcctcagcaccatcctgctcctgctg
ggtggcctgtgcatcggtgctggcaggatctacagccgcaagaacaacatcgtcctcagt
gccggcatcctcttcgtggctgcaggcctcagtaacatcatcggtatcatcgtctacatt
tccagcaacacaggtgacccgagtgacaagcgggacgaagacaaaaagaaccattacaac
tacggctggtctttttactttggagctctgtctttcattgtggctgagaccgtgggcgtc
ctggctgtaaacatttacattgagaaaaataaagagttgaggtttaagaccaaacgggaa
ttccttaaggcgtcttcctcttctccttatgccaggatgccgagctacaggtaccggcga
cggcgctcgaggtccagctcaaggtccaccgaggcctcgccctccagggacgtgtcgccc
atgggcctgaagatcacaggggccatccccatgggggagctgtccatgtacacgctgtcc
agggagcccctcaaggtgaccaccgcagccagctacagccccgaccaggaggccagcttc
ctgcaggtgcatgactttttccagcaggacctgaaggaaggtttccacgtcagcatgctg
aaccgacggacgacccctgtgtga

DBGET integrated database retrieval system