KEGG   Homo sapiens (human): 27101Help
Entry
27101             CDS       T01001                                 

Gene name
CACYBP, GIG5, PNAS-107, S100A6BP, SIP
Definition
(RefSeq) calcyclin binding protein
  KO
K04507  calcyclin binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    27101 (CACYBP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Siah-Interact_N CS SGS Tox-GHH
Motif
Other DBs
NCBI-GeneID: 27101
NCBI-ProteinID: NP_055227
OMIM: 606186
HGNC: 30423
Ensembl: ENSG00000116161
Vega: OTTHUMG00000034941
Pharos: Q9HB71(Tbio)
UniProt: Q9HB71 A0A024R904
Structure
PDB: 

Position
1q25.1
AA seq 228 aa AA seqDB search
MASEELQKDLEEVKVLLEKATRKRVRDALTAEKSKIETEIKNKMQQKSQKKAELLDNEKP
AAVVAPITTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKNL
NGKSYSMIVNNLLKPISVEGSSKKVKTDTVLILCRKKVENTRWDYLTQVEKECKEKEKPS
YDTETDPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAKGDTEF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atggcttcagaagagctacagaaagatctagaagaggtaaaggtgttgctggaaaaggct
actaggaaaagagtacgtgatgcccttacagctgaaaaatccaagattgagacagaaatc
aagaacaagatgcaacagaaatcacagaagaaagcagaacttcttgataatgaaaaacca
gctgctgtggttgctcccattacaacgggctatacggtgaaaatcagtaattatggatgg
gatcagtcagataagtttgtgaaaatctacattaccttaactggagttcatcaagttccc
actgagaatgtgcaggtgcatttcacagagaggtcatttgatcttttggtaaagaatcta
aatgggaagagttactccatgattgtgaacaatctcttgaaacccatctctgtggaaggc
agttcaaaaaaagtcaagactgatacagttcttatattgtgtagaaagaaagtggaaaac
acaaggtgggattacctgacccaggttgaaaaggagtgcaaagaaaaagagaagccctcc
tatgacactgaaacagatcctagtgagggattgatgaatgttctaaagaaaatttatgaa
gatggagacgatgatatgaagcgaaccattaataaagcctgggtggaatcaagagagaag
caagccaaaggagacacggaattttga

DBGET integrated database retrieval system