KEGG   Homo sapiens (human): 27106Help
Entry
27106             CDS       T01001                                 

Gene name
ARRDC2, CLONE24945, PP2703
Definition
(RefSeq) arrestin domain containing 2
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Arrestin_N Arrestin_C Rgp1
Motif
Other DBs
NCBI-GeneID: 27106
NCBI-ProteinID: NP_056498
HGNC: 25225
Ensembl: ENSG00000105643
Vega: OTTHUMG00000183483
Pharos: Q8TBH0(Tdark)
UniProt: Q8TBH0 A0A024R7K1
Position
19p13.11
AA seq 407 aa AA seqDB search
MLFDKVKAFSVQLDGATAGVEPVFSGGQAVAGRVLLELSSAARVGALRLRARGRAHVHWT
ESRSAGSSTAYTQSYSERVEVVSHRATLLAPDTGETTTLPPGRHEFLFSFQLPPTLVTSF
EGKHGSVRYCIKATLHRPWVPARRARKVFTVIEPVDINTPALLAPQAGAREKVARSWYCN
RGLVSLSAKIDRKGYTPGEVIPVFAEIDNGSTRPVLPRAAVVQTQTFMARGARKQKRAVV
ASLAGEPVGPGQRALWQGRALRIPPVGPSILHCRVLHVDYALKVCVDIPGTSKLLLELPL
VIGTIPLHPFGSRSSSVGSHASFLLDWRLGALPERPEAPPEYSEVVADTEEAALGQSPFP
LPQDPDMSLEGPFFAYIQEFRYRPPPLYSEEDPNPLLGDMRPRCMTC
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgctattcgacaaggtgaaagcgttctcggtgcagttggacggcgcgaccgcgggcgtc
gagcccgtgtttagcggcggccaggccgtggcgggccgggtgctgctggagctgtcaagc
gccgcgcgtgtgggtgccctgaggctgcgcgcgcggggccgcgcccacgtgcactggacc
gagtcgcgcagcgcgggctcgagcacggcttacacgcagagctacagtgaacgcgtggag
gtcgtgagccaccgcgccacgctcctggcgccagataccggggagaccacgacgctgcct
cctgggcgccatgagttcctgttcagcttccagctgcccccgaccctggtgacatccttc
gagggcaaacacggtagtgtccgctactgtatcaaggccaccctgcaccggccctgggtc
ccagcacgccgggcaaggaaggtgttcactgtcatcgagcctgtggacatcaacacgcca
gccctgctggcacctcaagcgggggctcgggaaaaggttgcccgatcctggtactgtaac
cgtggcctagtctccctttcggccaagatcgaccgcaagggctacaccccaggagaggtc
atccctgtctttgccgagatcgacaacggctccacacgtcctgtgctgcctcgggcagcc
gtggtgcagacacagacgttcatggcccgaggcgcccgaaagcagaaacgggcagtggtg
gccagcctcgcgggcgagccggtgggccccgggcagcgggcgctgtggcagggccgggca
ctgcggatccccccagtgggtccttccatcctgcactgccgcgttctacacgtggactac
gcactcaaggtctgtgtggatatcccaggaacgtccaagctgctgctggagctgccactg
gtgatcggcaccattcccttgcacccttttggcagccgttcctccagcgtgggcagccac
gccagcttcctgctggactggaggctgggggccttgccggagcggcctgaggctcctcct
gagtactcggaggtggtagccgacactgaggaggcagccttggggcagagccccttcccg
cttccgcaggaccccgacatgagccttgaaggcccgttcttcgcctacatccaagagttc
cgctaccgcccgccacccctgtactctgaggaggatccaaacccactcttgggggacatg
aggccgcgctgcatgacttgctga

DBGET integrated database retrieval system