KEGG   Homo sapiens (human): 27121Help
Entry
27121             CDS       T01001                                 

Gene name
DKK4, DKK-4
Definition
(RefSeq) dickkopf WNT signaling pathway inhibitor 4
  KO
K02165  dickkopf
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    27121 (DKK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dickkopf_N Prokineticin
Motif
Other DBs
NCBI-GeneID: 27121
NCBI-ProteinID: NP_055235
OMIM: 605417
HGNC: 2894
Ensembl: ENSG00000104371
Vega: OTTHUMG00000164167
Pharos: Q9UBT3(Tbio)
UniProt: Q9UBT3
Position
8p11.21
AA seq 224 aa AA seqDB search
MVAAVLLGLSWLCSPLGALVLDFNNIRSSADLHGARKGSQCLSDTDCNTRKFCLQPRDEK
PFCATCRGLRRRCQRDAMCCPGTLCVNDVCTTMEDATPILERQLDEQDGTHAEGTTGHPV
QENQPKRKPSIKKSQGRKGQEGESCLRTFDCGPGLCCARHFWTKICKPVLLEGQVCSRRG
HKDTAQAPEIFQRCDCGPGLLCRSQLTSNRQHARLRVCQKIEKL
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggtggcggccgtcctgctggggctgagctggctctgctctcccctgggagctctggtc
ctggacttcaacaacatcaggagctctgctgacctgcatggggcccggaagggctcacag
tgcctgtctgacacggactgcaataccagaaagttctgcctccagccccgcgatgagaag
ccgttctgtgctacatgtcgtgggttgcggaggaggtgccagcgagatgccatgtgctgc
cctgggacactctgtgtgaacgatgtttgtactacgatggaagatgcaaccccaatatta
gaaaggcagcttgatgagcaagatggcacacatgcagaaggaacaactgggcacccagtc
caggaaaaccaacccaaaaggaagccaagtattaagaaatcacaaggcaggaagggacaa
gagggagaaagttgtctgagaacttttgactgtggccctggactttgctgtgctcgtcat
ttttggacgaaaatttgtaagccagtccttttggagggacaggtctgctccagaagaggg
cataaagacactgctcaagctccagaaatcttccagcgttgcgactgtggccctggacta
ctgtgtcgaagccaattgaccagcaatcggcagcatgctcgattaagagtatgccaaaaa
atagaaaagctataa

DBGET integrated database retrieval system