KEGG   Homo sapiens (human): 27123Help
Entry
27123             CDS       T01001                                 

Gene name
DKK2, DKK-2
Definition
(RefSeq) dickkopf WNT signaling pathway inhibitor 2
  KO
K02165  dickkopf
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    27123 (DKK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dickkopf_N DUF4501
Motif
Other DBs
NCBI-GeneID: 27123
NCBI-ProteinID: NP_055236
OMIM: 605415
HGNC: 2892
Ensembl: ENSG00000155011
Vega: OTTHUMG00000131216
Pharos: Q9UBU2(Tbio)
UniProt: Q9UBU2
Position
4q25
AA seq 259 aa AA seqDB search
MAALMRSKDSSCCLLLLAAVLMVESSQIGSSRAKLNSIKSSLGGETPGQAANRSAGMYQG
LAFGGSKKGKNLGQAYPCSSDKECEVGRYCHSPHQGSSACMVCRRKKKRCHRDGMCCPST
RCNNGICIPVTESILTPHIPALDGTRHRDRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEG
DPCLRSSDCIEGFCCARHFWTKICKPVLHQGEVCTKQRKKGSHGLEIFQRCDCAKGLSCK
VWKDATYSSKARLHVCQKI
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgttgatgcggagcaaggattcgtcctgctgcctgctcctactggccgcggtg
ctgatggtggagagctcacagatcggcagttcgcgggccaaactcaactccatcaagtcc
tctctgggcggggagacgcctggtcaggccgccaatcgatctgcgggcatgtaccaagga
ctggcattcggcggcagtaagaagggcaaaaacctggggcaggcctacccttgtagcagt
gataaggagtgtgaagttgggaggtattgccacagtccccaccaaggatcatcggcctgc
atggtgtgtcggagaaaaaagaagcgctgccaccgagatggcatgtgctgccccagtacc
cgctgcaataatggcatctgtatcccagttactgaaagcatcttaacccctcacatcccg
gctctggatggtactcggcacagagatcgaaaccacggtcattactcaaaccatgacttg
ggatggcagaatctaggaagaccacacactaagatgtcacatataaaagggcatgaagga
gacccctgcctacgatcatcagactgcattgaagggttttgctgtgctcgtcatttctgg
accaaaatctgcaaaccagtgctccatcagggggaagtctgtaccaaacaacgcaagaag
ggttctcatgggctggaaattttccagcgttgcgactgtgcgaagggcctgtcttgcaaa
gtatggaaagatgccacctactcctccaaagccagactccatgtgtgtcagaaaatttga

DBGET integrated database retrieval system