KEGG   Homo sapiens (human): 27127
Entry
27127             CDS       T01001                                 

Gene name
SMC1B, SMC1BETA, SMC1L2
Definition
(RefSeq) structural maintenance of chromosomes 1B
  KO
K06636  structural maintenance of chromosome 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    27127 (SMC1B)
   04114 Oocyte meiosis
    27127 (SMC1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    27127 (SMC1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Cohesin complex
    27127 (SMC1B)
  Meiosis-specific sister chromatid cohesion proteins
    27127 (SMC1B)
SSDB
Motif
Pfam: SMC_N SMC_hinge AAA_15 AAA_21 AAA_29 SbcCD_C ABC_tran
Other DBs
NCBI-GeneID: 27127
NCBI-ProteinID: NP_683515
OMIM: 608685
HGNC: 11112
Ensembl: ENSG00000077935
Vega: OTTHUMG00000151334
Pharos: Q8NDV3(Tbio)
UniProt: Q8NDV3
Position
22q13.31
AA seq 1235 aa
MAHLELLLVENFKSWRGRQVIGPFRRFTCIIGPNGSGKSNVMDALSFVMGEKIANLRVKN
IQELIHGAHIGKPISSSASVKIIYVEESGEEKTFARIIRGGCSEFRFNDNLVSRSVYIAE
LEKIGIIVKAQNCLVFQGTVESISVKKPKERTQFFEEISTSGELIGEYEEKKRKLQKAEE
DAQFNFNKKKNIAAERRQAKLEKEEAERYQSLLEELKMNKIQLQLFQLYHNEKKIHLLNT
KLEHVNRDLSVKRESLSHHENIVKARKKEHGMLTRQLQQTEKELKSVETLLNQKRPQYIK
AKENTSHHLKKLDVAKKSIKDSEKQCSKQEDDIKALETELADLDAAWRSFEKQIEEEILH
KKRDIELEASQLDRYKELKEQVRKKVATMTQQLEKLQWEQKTDEERLAFEKRRHGEVQGN
LKQIKEQIEDHKKRIEKLEEYTKTCMDCLKEKKQQEETLVDEIEKTKSRMSEVNEELNLI
RSELQNAGIDTHEGKRQQKRAEVLEHLKRLYPDSVFGRLFDLCHPIHKKYQLAVTKVFGR
FITAIVVASEKVAKDCIRFLKEERAEPETFLALDYLDIKPINERLRELKGCKMVIDVIKT
QFPQLKKVIQFVCGNGLVCETMEEARHIALSGPERQKTVALDGTLFLKSGVISGGSSDLK
YKARCWDEKELKNLRDRRSQKIQELKGLMKTLRKETDLKQIQTLIQGTQTRLKYSQNELE
MIKKKHLVAFYQEQSQLQSELLNIESQCIMLSEGIKERQRRIKEFQEKIDKVEDDIFQHF
CEEIGVENIREFENKHVKRQQEIDQKRLEFEKQKTRLNVQLEYSRSHLKKKLNKINTLKE
TIQKGSEDIDHLKKAEENCLQTVNELMAKQQQLKDIRVTQNSSAEKVQTQIEEERKKFLA
VDREVGKLQKEVVSIQTSLEQKRLEKHNLLLDCKVQDIEIILLSGSLDDIIEVEMGTEAE
STQATIDIYEKEEAFEIDYSSLKEDLKALQSDQEIEAHLRLLLQQVASQEDILLKTAAPN
LRALENLKTVRDKFQESTDAFEASRKEARLCRQEFEQVKKRRYDLFTQCFEHVSISIDQI
YKKLCRNNSAQAFLSPENPEEPYLEGISYNCVAPGKRFMPMDNLSGGEKCVAALALLFAV
HSFRPAPFFVLDEVDAALDNTNIGKVSSYIKEQTQDQFQMIVISLKEEFYSRADALIGIY
PEYDDCMFSRVLTLDLSQYPDTEGQESSKRHGESR
NT seq 3708 nt   +upstreamnt  +downstreamnt
atggcccacctggagctgctgcttgtggaaaatttcaagtcgtggcggggccgccaggtc
attggccccttccggaggttcacctgcatcatcggccccaacggctctggaaaatctaat
gtaatggatgcacttagttttgtaatgggagagaaaatagctaatttaagagtgaaaaat
attcaagaactcattcatggagcacatattggaaaacctatttcttcttctgcaagtgta
aaaattatatatgtggaggaaagtggcgaagagaaaacatttgcaaggattatccgaggg
ggatgctcagaatttcgctttaatgataatcttgtgagtcgttctgtttacattgcagag
ttggaaaagataggcataatagtcaaagcacaaaattgtttggtttttcagggaactgta
gagtcaatttcagtgaagaaacccaaagaaaggacccagttttttgaggaaatcagcact
tcaggagagcttataggagaatatgaagaaaagaaaagaaagttacaaaaagccgaagag
gatgcacagtttaactttaataagaaaaaaaatatagcggcagagcgcagacaagcaaaa
ttagagaaggaagaggcagaacgttaccagagtctccttgaagaactgaaaatgaacaag
atacaactgcagctttttcaactataccataatgagaaaaagattcatctcctgaacacc
aagttagagcatgtgaatagggatttgagtgtcaaaagagagtctttgtctcatcatgaa
aacatagttaaagccaggaaaaaggaacatggaatgctaactagacaactacaacaaaca
gaaaaagaattaaaatcggttgaaacccttttaaatcagaagaggcctcagtacattaaa
gccaaagaaaacacttctcaccaccttaagaaattagatgtggctaagaaatcaataaag
gacagcgaaaaacaatgttctaaacaggaagatgatataaaagccctggagacagagctg
gctgatttagatgctgcatggagaagttttgaaaagcagattgaggaagaaattttacat
aaaaagcgagacattgaactggaagccagtcagctggatcgttataaagaacttaaggaa
caagtaagaaagaaagtagctacaatgactcaacaactggaaaaactgcagtgggaacag
aagacagatgaagaaagactggcatttgaaaagaggaggcatggagaagttcagggaaat
ctaaaacaaataaaagaacaaatagaagatcataaaaaacgaatagagaagttagaggag
tatacaaagacatgcatggattgcttgaaagagaaaaaacagcaagaggaaaccctagtg
gatgaaattgaaaaaacaaaatcaagaatgtctgaagttaatgaagaattgaatcttatt
agaagtgaattgcagaatgctgggattgatacccatgagggaaaacgtcagcaaaagaga
gcagaggttctggaacaccttaaaagactgtacccagattctgtgtttggaagactattt
gacctgtgtcatcctattcataagaaataccagctggctgttactaaggtttttggccgg
ttcatcactgccattgttgtagcctctgaaaaggtagcaaaagattgtattcgatttctg
aaggaggaaagagctgaacctgagacattcctcgctctagattaccttgatatcaagcca
atcaatgaaagactaagggagcttaaaggctgtaaaatggtgattgatgtcataaagact
cagtttcctcagctgaagaaagtgattcagtttgtgtgtggaaatggtcttgtttgtgag
actatggaagaagcaaggcatattgcactcagtggacctgaaagacagaaaacagtagct
cttgatggaacattatttttaaaatctggagtgatctctggagggtcaagtgacttaaaa
tacaaggctagatgctgggatgagaaagagttaaagaatctaagagacagacgaagccag
aaaatccaagagctaaagggtttaatgaagacactccgcaaagaaacagatttgaaacaa
atacagaccctgatacagggaactcaaacacgactcaaatattcacaaaatgaactagag
atgattaagaagaagcaccttgttgctttttaccaggaacaatctcagttacaaagtgaa
ctactaaatattgagtctcaatgtattatgttgagtgaaggaatcaaggaacgacaacga
agaattaaagaatttcaagaaaagatagataaggtagaagacgatatcttccaacacttc
tgtgaagaaattggcgtggaaaatattcgtgaatttgagaacaaacatgttaaacggcaa
caagaaattgatcaaaaaagattagaatttgaaaaacaaaaaactcggcttaatgttcaa
cttgagtatagtcgcagtcaccttaagaagaaactgaataagatcaacacattaaaagaa
actatccagaaaggtagtgaagatattgatcacctaaagaaggctgaagaaaactgtctg
cagacagtgaatgaactcatggcaaagcagcagcaacttaaggacatacgtgtcactcag
aactccagtgccgagaaagttcaaactcaaattgaagaggaacggaagaagtttctggct
gttgatagggaagtggggaaattgcaaaaagaagttgtaagtattcaaacttctctggaa
cagaaacgattagagaagcataacttgctgcttgattgcaaagtgcaagacattgagata
atccttttgtcggggtcactggatgacatcattgaagtggagatgggaactgaagcagaa
agtacccaggcaacaattgatatctatgaaaaagaagaagcctttgaaatagactacagc
tctctaaaagaggatttgaaggctctacagtctgatcaagaaatcgaggcccaccttagg
ctcttattgcagcaagtagcatcccaggaagatatcttactgaaaacagcagccccaaac
ctacgagcactggagaacttaaagactgtcagagacaagtttcaagagtccacagatgct
tttgaggccagcagaaaggaagccagactgtgtaggcaagagttcgagcaagtgaaaaaa
aggagatacgatcttttcacccagtgttttgagcatgtctcaatctcaattgatcaaatc
tacaagaagctctgcagaaacaacagcgcccaagcatttcttagcccagagaaccctgaa
gaaccttacttggagggaattagctataactgtgtggccccaggcaaacggtttatgcca
atggacaatttgtcagggggagaaaagtgtgtggcagccttggctctcctgtttgctgtg
cacagttttcgtcctgccccattctttgttttagatgaagtggatgcagccctagacaat
actaacataggcaaagtgtcaagttacatcaaagagcaaactcaagaccagtttcagatg
atagtcatctccctaaaagaagagttctattccagagccgacgcgctgatcggcatctat
cctgagtacgatgactgcatgttcagccgagttttgaccctagatctttctcagtatcca
gacactgaaggccaagaaagcagcaagagacacggagagtcccgctag

DBGET integrated database retrieval system