KEGG   Homo sapiens (human): 27154Help
Entry
27154             CDS       T01001                                 

Gene name
BRPF3
Definition
(RefSeq) bromodomain and PHD finger containing 3
  KO
K11350  bromodomain and PHD finger-containing protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    27154 (BRPF3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HAT complexes
    MOZ/MORF complex
     27154 (BRPF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-HC5HC2H_2 EPL1 zf-HC5HC2H Bromodomain PWWP PHD_2 PHD FYVE_2 Elf-1_N DNA_topoisoIV
Motif
Other DBs
NCBI-GeneID: 27154
NCBI-ProteinID: NP_056510
OMIM: 616856
HGNC: 14256
Ensembl: ENSG00000096070
Vega: OTTHUMG00000014589
Pharos: Q9ULD4(Tdark)
UniProt: Q9ULD4
Structure
PDB: 

Position
6p21.31
AA seq 1205 aa AA seqDB search
MRKPRRKSRQNAEGRRSPSPYSLKCSPTRETLTYAQAQRIVEVDIDGRLHRISIYDPLKI
ITEDELTAQDITECNSNKENSEQPQFPGKSKKPSSKGKKKESCSKHASGTSFHLPQPSFR
MVDSGIQPEAPPLPAAYYRYIEKPPEDLDAEVEYDMDEEDLAWLDMVNEKRRVDGHSLVS
ADTFELLVDRLEKESYLESRSSGAQQSLIDEDAFCCVCLDDECHNSNVILFCDICNLAVH
QECYGVPYIPEGQWLCRCCLQSPSRPVDCILCPNKGGAFKQTSDGHWAHVVCAIWIPEVC
FANTVFLEPIEGIDNIPPARWKLTCYICKQKGLGAAIQCHKVNCYTAFHVTCAQRAGLFM
KIEPMRETSLNGTIFTVRKTAYCEAHSPPGAATARRKGDSPRSISETGDEEGLKEGDGEE
EEEEEVEEEEQEAQGGVSGSLKGVPKKSKMSLKQKIKKEPEEAGQDTPSTLPMLAVPQIP
SYRLNKICSGLSFQRKNQFMQRLHNYWLLKRQARNGVPLIRRLHSHLQSQRNAEQREQDE
KTSAVKEELKYWQKLRHDLERARLLIELIRKREKLKREQVKVQQAAMELELMPFNVLLRT
TLDLLQEKDPAHIFAEPVNLSEVPDYLEFISKPMDFSTMRRKLESHLYRTLEEFEEDFNL
IVTNCMKYNAKDTIFHRAAVRLRDLGGAILRHARRQAENIGYDPERGTHLPESPKLEDFY
RFSWEDVDNILIPENRAHLSPEVQLKELLEKLDLVSAMRSSGARTRRVRLLRREINALRQ
KLAQPPPPQPPSLNKTVSNGELPAGPQGDAAVLEQALQEEPEDDGDRDDSKLPPPPTLEP
TGPAPSLSEQESPPEPPTLKPINDSKPPSRFLKPRKVEEDELLEKSPLQLGNEPLQRLLS
DNGINRLSLMAPDTPAGTPLSGVGRRTSVLFKKAKNGVKLQRSPDRVLENGEDHGVAGSP
ASPASIEEERHSRKRPRSRSCSESEGERSPQQEEETGMTNGFGKHTESGSDSECSLGLSG
GLAFEACSGLTPPKRSRGKPALSRVPFLEGVNGDSDYNGSGRSLLLPFEDRGDLEPLELV
WAKCRGYPSYPALIIDPKMPREGLLHNGVPIPVPPLDVLKLGEQKQAEAGEKLFLVLFFD
NKRTWQWLPRDKVLPLGVEDTVDKLKMLEGRKTSIRKSVQVAYDRAMIHLSRVRGPHSFV
TSSYL
NT seq 3618 nt NT seq  +upstreamnt  +downstreamnt
atgaggaagcctcgtcggaagtcccggcagaatgccgagggccggcgttccccgtccccc
tacagtctcaagtgctcacccacccgggagaccctgacatatgcccaggcccagcggatt
gtcgaggtagacattgatggacgcctgcatcgtatcagcatctatgacccactcaaaatc
attactgaagatgagctaactgcccaggatatcaccgaatgcaatagtaacaaggaaaac
agtgaacagcctcagttccctggcaagtccaagaaaccctcatccaagggcaaaaagaag
gaatcctgctccaagcatgcatctggtacttccttccacctcccacagcccagcttccgt
atggtggactcaggcatccagccagaagcacccccgctgcctgctgcctactaccgctac
attgagaagccacctgaagacctggatgcagaggtagagtatgacatggatgaggaggac
cttgcctggctggacatggtgaatgaaaaacggcgagtagatgggcacagtttggtgtct
gcagatacctttgagctgctggtagaccggcttgagaaagagtcatacttggagagtcgc
agcagtggggcccaacagtcactcatcgatgaagacgctttctgctgtgtgtgcctggat
gatgaatgtcacaatagcaatgttattctcttctgtgacatctgcaacctggctgtacac
caggagtgctatggcgtcccatacatccctgagggccagtggctatgccgctgctgcctg
cagtctccctcccggcctgtggattgcatcctttgccccaataagggtggcgccttcaaa
cagaccagtgatgggcactgggcccatgtggtgtgtgccatctggatccctgaagtctgc
tttgctaacaccgtgttcttggaacctattgagggcattgacaatatcccgcctgcccgc
tggaaactaacctgctatatctgcaagcagaaagggctaggtgcagccatccagtgccat
aaggtgaactgctacacagcattccatgtgacatgtgcacagcgggctgggctcttcatg
aagattgagcccatgcgcgaaaccagcctcaatggcaccatctttacagtgcgcaagact
gcctactgtgaggcccactcgccaccaggtgcggccactgctaggaggaagggcgactcc
cctagaagcatcagtgagactggcgatgaggaagggctgaaggagggtgatggagaggag
gaagaagaggaagaggtggaggaagaagagcaggaagctcaaggcggggtgagtggctcc
ctcaagggagtgcccaagaaaagcaagatgagtttgaagcagaagatcaagaaggagcca
gaggaagcaggccaagacacaccctccactctccccatgcttgctgtcccacagataccc
tcttacaggttgaacaagatctgtagtggtctctcctttcagaggaaaaaccagtttatg
cagcggcttcacaattattggctgttgaagcggcaggcacggaatggtgtccctcttatc
cggcgcttgcactcccatctgcagtcccaaagaaacgctgagcagcgagagcaggatgag
aagacaagtgcagtgaaggaggagctgaagtattggcagaagctccggcatgacttggag
cgggcgcggctgctgattgagctgattcggaagagagagaagctcaaacgagagcaggtc
aaagtccagcaggctgccatggagctggagctgatgccattcaatgttctgttgaggaca
acactggacctgctgcaggagaaggatcctgcacacatcttcgcagaaccagtcaacttg
agtgaggttccagattacctggaattcatatccaagccaatggatttttctactatgagg
cggaagctggagtcccacctgtaccgcaccttggaggagtttgaggaggactttaacctt
atagttaccaactgcatgaagtataatgctaaagacacaattttccaccgagcagctgtc
cgcctgcgggacctgggaggggccatcctacggcacgcccggcggcaggcagagaacatc
ggctatgaccccgagaggggcactcacctgcccgagtcacccaaattggaagacttttac
cgcttctcctgggaagacgtggacaacatcctcatcccagagaaccgggcccatttgtcc
ccagaggtgcagctgaaggagctgctggagaaactggacctggtgagcgccatgcggtcc
agtggggcccgcacccgtcgtgtccgcctgctacgccgggagatcaatgcccttcggcag
aagctggcacagccaccaccaccacagccaccatcactcaacaagacagtatccaatggg
gagctgccagcagggccccagggggatgcagctgtgctggagcaggccttgcaggaggag
ccagaagacgatggggacagagatgactccaaactgcctcctccgccaaccctggagccc
actgggcctgcaccttccttgtctgagcaagaatcccccccggagccccctactctgaaa
cccattaatgatagcaaacctccaagcaggttcctaaagcccagaaaggtggaagaagat
gagctcttggaaaaatcaccactgcagctagggaatgagcctttgcaacgcttgctcagt
gacaatggcatcaacagactatccctcatggcccctgacaccccggccggtaccccactt
agtggtgtgggtcgccgcacatcagtcctcttcaagaaggccaagaatggggttaagcta
cagagaagcccagacagggtcctggagaatggcgaggaccatggtgtggcaggctctcct
gcctctccagccagcatcgaggaagagcgccactcccggaagcggccaaggagcaggagc
tgtagtgagagcgaaggggagaggtccccccagcaggaggaagagacaggcatgaccaac
ggctttggaaaacacaccgaaagcgggtctgactctgaatgtagtttgggtctcagtggt
ggactggcatttgaagcttgcagtggtctgacgccccccaaacgcagccgtgggaagcca
gccctgtctcgagtgcccttcctggaaggtgtgaacggagactctgactacaatggctca
ggcagaagcctcctgctgccctttgaagaccgcggagacctggagcccttggagctggtg
tgggccaagtgccgaggctacccctcctaccctgccttgatcatcgatcccaagatgccc
cgggagggcctcctgcacaatggcgttcccatccctgtccccccgctggacgtgctgaag
ctgggagagcagaaacaggcagaggctggagagaagctcttccttgtcctcttctttgac
aacaagcgcacctggcagtggcttccaagggacaaagtcctgcccttgggtgtggaagac
accgtggacaagctcaagatgctggaaggccgcaagaccagcatccgcaagtcagtgcag
gtggcctatgaccgtgcgatgatccacctgagcagagtccgggggccccactccttcgtc
acttccagctacctgtaa

DBGET integrated database retrieval system