KEGG   Homo sapiens (human): 27158Help
Entry
27158             CDS       T01001                                 

Gene name
NDOR1, CIAE1, NR1, bA350O14.9
Definition
(RefSeq) NADPH dependent diflavin oxidoreductase 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 27158
NCBI-ProteinID: NP_055249
OMIM: 606073
HGNC: 29838
Ensembl: ENSG00000188566
Vega: OTTHUMG00000020986
Pharos: Q9UHB4(Tbio)
UniProt: Q9UHB4
Structure
PDB: 

Position
9q34.3
AA seq 597 aa AA seqDB search
MPSPQLLVLFGSQTGTAQDVSERLGREARRRRLGCRVQALDSYPVVNLINEPLVIFVCAT
TGQGDPPDNMKNFWRFIFRKNLPSTALCQMDFAVLGLGDSSYAKFNFVAKKLHRRLLQLG
GSALLPVCLGDDQHELGPDAAVDPWLRDLWDRVLGLYPPPPGLTEIPPGVPLPSKFTLLF
LQEAPSTGSEGQRVAHPGSQEPPSESKPFLAPMISNQRVTGPSHFQDVRLIEFDILGSGI
SFAAGDVVLIQPSNSAAHVQRFCQVLGLDPDQLFMLQPREPDVSSPTRLPQPCSMRHLVS
HYLDIASVPRRSFFELLACLSLHELEREKLLEFSSAQGQEELFEYCNRPRRTILEVLCDF
PHTAAAIPPDYLLDLIPVIRPRAFSIASSLLTHPSRLQILVAVVQFQTRLKEPRRGLCSS
WLASLDPGQGPVRVPLWVRPGSLAFPETPDTPVIMVGPGTGVAPFRAAIQERVAQGQTGN
FLFFGCRWRDQDFYWEAEWQELEKRDCLTLIPAFSREQEQKVYVQHRLRELGSLVWELLD
RQGAYFYLAGNAKSMPADVSEALMSIFQEEGGLCSPDAAAYLARLQQTRRFQTETWA
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcccgcagcttctggtgctcttcggcagccagacaggcacggctcaggatgtg
tcggagagactgggtcgcgaggcccggcgccggcggcttggctgccgggtgcaggccctg
gactcctacccggtggtgaatctgattaacgagcccctggtgatatttgtttgtgcaact
acaggccaaggagacccccctgacaacatgaagaacttctggaggtttatattccggaag
aacctgccctccactgccctctgtcagatggactttgccgtcctgggcctcggggactcc
tcatacgccaagttcaacttcgtggccaagaagctgcaccgacggctactgcagcttggg
ggcagcgccctcctgcccgtgtgcctgggcgatgaccagcatgagctggggcccgacgct
gctgtggacccctggctgcgagacttgtgggacagggttctggggctgtacccgccgcct
ccgggcctcactgagatccctcccggagtccccctgccctccaagttcaccctgctgttc
ctccaagaggcacccagcacgggctctgaggggcagcgggtagctcaccccggctctcag
gagcccccgtcagagtcgaagcccttcctagcacccatgatctccaaccagagagtcacc
ggcccctcccacttccaggacgttcggctgattgagtttgacatcttgggctctggcatc
agctttgctgctggtgatgtggtgctgattcagccctccaactcggctgcccatgtccag
cggttctgccaggtgctgggcctggaccctgaccagctcttcatgctgcagccgcgggag
ccagatgtctcctcccccacgaggctgccccagccctgctccatgcggcacctcgtgtcc
cactacctggacatcgccagcgtgcctcgccgctccttcttcgaactcctggcctgtcta
tccctccatgagctggagcgggagaagctgctggagttcagttctgcccaaggccaggag
gagctctttgaatactgcaaccggccccgcaggaccatcctggaggtgctctgtgacttc
ccgcacacagctgccgccatccctcccgactacctgttggacctcatccccgttatccgg
ccgagggccttctccatcgcctcctcgctgctgactcacccctcacggctgcagatcctc
gtggctgtagtgcagttccagactcgcctcaaggagccccgccggggcctctgctcctcc
tggctggcatccctggaccctgggcaaggacctgtccgggtgcccctctgggtgcggcct
gggagtctggccttcccagagacaccagacacacctgtgatcatggtggggcctggcact
ggggtagcccccttccgagcagccatccaggagcgtgtggcccagggccagactggaaac
ttcttgttttttggctgccgctggcgggaccaagacttctactgggaggctgagtggcag
gagctggagaagcgggactgtctgaccctcatccctgccttctcccgggaacaggagcag
aaagtatatgtgcagcaccggctccgggagctggggtcgcttgtgtgggaactgctggac
cgccagggtgcatacttctacctggcaggcaacgccaagtccatgccagcggacgtctcg
gaagccctgatgtccatcttccaggaggagggtggactctgcagcccggacgcagccgcg
tatctagccaggctccagcagacacggcgcttccagacagagacgtgggcctga

DBGET integrated database retrieval system