KEGG   Homo sapiens (human): 27175
Entry
27175             CDS       T01001                                 
Symbol
TUBG2
Name
(RefSeq) tubulin gamma 2
  KO
K10389  tubulin gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04814  Motor proteins
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09142 Cell motility
   04814 Motor proteins
    27175 (TUBG2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    27175 (TUBG2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    27175 (TUBG2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    27175 (TUBG2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Microtubules and associated factors
    gamma-tubulin ring complex
     27175 (TUBG2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    27175 (TUBG2)
SSDB
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII
Other DBs
NCBI-GeneID: 27175
NCBI-ProteinID: NP_057521
OMIM: 605785
HGNC: 12419
Ensembl: ENSG00000037042
UniProt: Q9NRH3
Position
17:42659284..42667006
AA seq 451 aa
MPREIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHY
IPRAVLLDLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFSQGEKIHEDIFD
IIDREADGSDSLEGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKLVQTYSVFPYQDEMSD
VVVQPYNSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSAST
TTLRYPGYMNNDLIGLIASLIPTPRLHFLMTGYTPLTTDQSVASVRKTTVLDVMRRLLQP
KNVMVSTGRDRQTNHCYIAILNIIQGEVDPTQVHKSLQRIRERKLANFIPWGPASIQVAL
SRKSPYLPSAHRVSGLMMANHTSISSLFESSCQQFDKLRKRDAFLEQFRKEDMFKDNFDE
MDRSREVVQELIDEYHAATQPDYISWGTQEQ
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgccccgggagatcatcaccctgcagctgggccagtgcggcaaccagattgggttcgag
ttctggaaacagctgtgcgccgagcatggtatcagccccgagggcatcgtggaggaattc
gccaccgagggcactgaccgcaaggacgtctttttctaccaggcagacgatgagcactac
atcccccgggccgtgctgctggacttggaaccccgggtgatccactccatcctcaactcc
ccctatgccaagctctacaacccagagaacatctacctgtcggaacatggaggaggagct
ggcaacaactgggccagcggattctcccagggtgagaaaattcatgaagacatctttgac
atcatagaccgagaagcagatggaagtgacagtttggagggcttcgtgctgtgtcactcc
atcgctgggggtacgggttctggcctgggctcctacctcctggagcgactgaatgacagg
taccccaagaagctagtgcagacttattcagtgtttccctaccaggacgagatgagcgac
gtagtggttcagccctacaattcactcctgacactcaagaggctgacgcagaacgcagat
tgtgtggtggtgctggacaacacagccctgaaccggattgccacagaccgcctgcacatc
cagaacccgtccttctcccagatcaaccagctggtgtccaccatcatgtcggccagcacc
accaccctgcgctaccccggctacatgaacaatgacctcatcggcctcatcgcctcgctc
attcccaccccacggctccacttcctcatgaccggctacaccccgctcactacagaccag
tcagtggccagcgtgaggaagaccacggtcctggatgtcatgaggcggctgctgcagccc
aagaacgtgatggtgtccacaggccgagaccgccagaccaaccactgctacatcgccatc
ctcaacatcatccagggagaggtggaccccacccaggtccacaagagcctgcagaggatc
cgggaacggaagttggccaacttcatcccgtggggccccgccagcatccaggtggccctg
tcgaggaagtctccctacctgccctcggcccaccgggtcagcgggctcatgatggccaac
cacaccagcatctcctcgctctttgaaagttcctgccagcagtttgacaagctgcggaag
cgggatgccttcctcgagcagttccgtaaggaggacatgttcaaggacaactttgatgag
atggacaggtctagggaggttgttcaggagctcattgatgagtaccatgcggccacccag
ccagactacatttcctggggcacccaggagcagtga

DBGET integrated database retrieval system