KEGG   Homo sapiens (human): 27181Help
Entry
27181             CDS       T01001                                 

Gene name
SIGLEC8, SAF2, SIGLEC-8, SIGLEC8L
Definition
(RefSeq) sialic acid binding Ig like lectin 8
  KO
K06748  sialic acid binding Ig-like lectin 8
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    27181 (SIGLEC8)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  27181 (SIGLEC8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 ig V-set Ig_2 I-set C2-set_2
Motif
Other DBs
NCBI-GeneID: 27181
NCBI-ProteinID: NP_055257
OMIM: 605639
HGNC: 10877
Ensembl: ENSG00000105366
Vega: OTTHUMG00000182776
Pharos: Q9NYZ4(Tbio)
UniProt: Q9NYZ4
Structure
PDB: 

Position
19q13.41
AA seq 499 aa AA seqDB search
MLLLLLLLPLLWGTKGMEGDRQYGDGYLLQVQELVTVQEGLCVHVPCSFSYPQDGWTDSD
PVHGYWFRAGDRPYQDAPVATNNPDREVQAETQGRFQLLGDIWSNDCSLSIRDARKRDKG
SYFFRLERGSMKWSYKSQLNYKTKQLSVFVTALTHRPDILILGTLESGHSRNLTCSVPWA
CKQGTPPMISWIGASVSSPGPTTARSSVLTLTPKPQDHGTSLTCQVTLPGTGVTTTSTVR
LDVSYPPWNLTMTVFQGDATASTALGNGSSLSVLEGQSLRLVCAVNSNPPARLSWTRGSL
TLCPSRSSNPGLLELPRVHVRDEGEFTCRAQNAQGSQHISLSLSLQNEGTGTSRPVSQVT
LAAVGGAGATALAFLSFCIIFIIVRSCRKKSARPAAGVGDTGMEDAKAIRGSASQGPLTE
SWKDGNPLKKPPPAVAPSSGEEGELHYATLSFHKVKPQDPQGQEATDSEYSEIKIHKRET
AETQACLRNHNPSSKEVRG
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgctgctgctgctgcccctgctctgggggacaaaggggatggagggagac
agacaatatggggatggttacttgctgcaagtgcaggagctggtgacggtgcaggagggc
ctgtgtgtccatgtgccctgctccttctcctacccccaggatggctggactgactctgac
ccagttcatggctactggttccgggcaggagacagaccataccaagacgctccagtggcc
acaaacaacccagacagagaagtgcaggcagagacccagggccgattccaactccttggg
gacatttggagcaacgactgctccctgagcatcagagacgccaggaagagggataagggg
tcatatttctttcggctagagagaggaagcatgaaatggagttacaaatcacagttgaat
tacaaaactaagcagctgtctgtgtttgtgacagccctgacccataggcctgacatcctc
atcctagggaccctagagtctggccactccaggaacctgacctgctctgtgccctgggcc
tgtaagcaggggacaccccccatgatctcctggattggggcctccgtgtcctccccgggc
cccactactgcccgctcctcagtgctcacccttaccccaaagccccaggaccacggcacc
agcctcacctgtcaggtgaccttgcctgggacaggtgtgaccacgaccagtaccgtccgc
ctcgatgtgtcctaccctccttggaacttgaccatgactgtcttccaaggagatgccaca
gcatccacagccctgggaaatggctcatctctttcagtccttgagggccagtctctgcgc
ctggtctgtgctgtcaacagcaatccccctgccaggctgagctggacccgggggagcctg
accctgtgcccctcacggtcctcaaaccctgggctgctggagctgcctcgagtgcacgtg
agggatgaaggggaattcacctgccgagctcagaacgctcagggctcccagcacatttcc
ctgagcctctccctgcagaatgagggcacaggcacctcaagacctgtatcacaagtgaca
ctggcagcagtcgggggagctggagccacagccctggccttcctgtccttctgcatcatc
ttcatcatagtgaggtcctgcaggaagaaatcggcaaggccagcagcgggcgtgggggat
acaggcatggaagatgcaaaggccatcaggggctcggcctctcagggacccctgactgaa
tcctggaaagatggcaaccccctgaagaagcctcccccagctgttgccccctcgtcaggg
gaggaaggagagctccattatgcaaccctcagcttccataaagtgaagcctcaggacccg
cagggacaggaggccactgacagtgaatactcggagatcaagatccacaagcgagaaact
gcagagactcaggcctgtttgaggaatcacaacccctccagcaaagaagtcagaggctga

DBGET integrated database retrieval system