KEGG   Homo sapiens (human): 27183
Entry
27183             CDS       T01001                                 

Gene name
VPS4A, SKD1, SKD1A, SKD2, VPS4, VPS4-1
Definition
(RefSeq) vacuolar protein sorting 4 homolog A
  KO
K12196  vacuolar protein-sorting-associated protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    27183 (VPS4A)
  09143 Cell growth and death
   04217 Necroptosis
    27183 (VPS4A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27183 (VPS4A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT-III complex
    27183 (VPS4A)
SSDB
Motif
Pfam: AAA Vps4_C MIT AAA_lid_3 TIP49 IstB_IS21 AAA_22 AAA_16 AAA_14 RuvB_N AAA_5 AAA_25 AAA_18 DUF815 AAA_2 AAA_33 AAA_17 RNA_helicase AAA_24 PhoH NACHT Mg_chelatase AAA_7 Sigma54_activat YhdB YCII Sigma54_activ_2 MCM
Other DBs
NCBI-GeneID: 27183
NCBI-ProteinID: NP_037377
OMIM: 609982
HGNC: 13488
Ensembl: ENSG00000132612
Vega: OTTHUMG00000175589
Pharos: Q9UN37(Tbio)
UniProt: Q9UN37 A0A024R705
Structure
PDB: 
2K3W 2JQ9 1YXR

Position
16q22.1
AA seq 437 aa
MTTSTLQKAIDLVTKATEEDKAKNYEEALRLYQHAVEYFLHAIKYEAHSDKAKESIRAKC
VQYLDRAEKLKDYLRSKEKHGKKPVKENQSEGKGSDSDSEGDNPEKKKLQEQLMGAVVME
KPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFTGKRTPWRGILLFGPPGTGKSYLAKAV
ATEANNSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENE
SEAARRIKTEFLVQMQGVGNNNDGTLVLGATNIPWVLDSAIRRRFEKRIYIPLPEEAARA
QMFRLHLGSTPHNLTDANIHELARKTEGYSGADISIIVRDSLMQPVRKVQSATHFKKVCG
PSRTNPSMMIDDLLTPCSPGDPGAMEMTWMDVPGDKLLEPVVCMSDMLRSLATTRPTVNA
DDLLKVKKFSEDFGQES
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgacaacgtcaaccctccagaaagccattgatctggtgacgaaagccacagaggaggac
aaagccaagaactacgaggaggcgctgcggctgtaccagcatgcggtggagtacttcctc
cacgctatcaagtatgaggcccacagcgacaaggccaaggagagcattcgagccaagtgc
gtgcagtacctagaccgggccgagaagctgaaggattatttacgaagcaaagagaaacac
ggcaagaagccagtcaaagagaaccagagtgagggcaagggcagtgacagtgacagtgaa
ggggataatccggagaaaaagaaactgcaagaacagctgatgggtgccgtcgtgatggag
aagcccaacatacggtggaacgacgtggccgggctggagggggccaaggaggccctcaaa
gaagctgtcattttgccaatcaaattcccacacttgttcacaggcaagcgcaccccctgg
cgggggattctgctgttcggaccccctggcacagggaaatcctacctggccaaagccgtg
gcaacagaggccaacaactccaccttcttctctgtgtcctcctcagatctgatgtccaag
tggctgggggagagtgaaaagctggtcaagaacctgtttgagctggccaggcagcacaag
ccctccatcatcttcatcgatgaggtggattccctctgcgggtcccgaaatgaaaatgag
agtgaggccgcccggaggatcaaaacggagttcttggtccagatgcagggggtggggaat
aacaatgatgggactctggttcttggagccacaaacatcccatgggtgttggattcggcc
atcaggaggaggtttgaaaaacgaatttatatccccttgccggaggaagctgcccgcgcc
cagatgttccggttgcatctcgggagcactccccacaacctcacggatgcaaacatccac
gagctggcccggaagacggaaggctactcgggcgcggacatcagcatcatcgtgcgggac
tctctcatgcagcccgtgaggaaggtgcagtcggccacacacttcaaaaaggtctgtggc
ccctctcgcaccaaccccagcatgatgattgatgacctcctgactccatgctcaccaggg
gacccaggagccatggagatgacttggatggatgtccctggggacaaactcttagagcct
gtggtttgcatgtcggacatgctgcggtctctggccaccacccggcccacggtgaatgca
gacgacctcctgaaagtgaagaaattctcagaggactttgggcaagagagttaa

DBGET integrated database retrieval system