KEGG   Homo sapiens (human): 2719Help
Entry
2719              CDS       T01001                                 

Gene name
GPC3, DGSX, GTR2-2, MXR7, OCI-5, SDYS, SGB, SGBS, SGBS1
Definition
(RefSeq) glypican 3
  KO
K08109  glypican 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
Disease
H00493  Heparan sulfate proteoglycan gene defects
H01215  Simpson-Golabi-Behmel syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    2719 (GPC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    2719 (GPC3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2719 (GPC3)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   2719 (GPC3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  2719 (GPC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican
Motif
Other DBs
NCBI-GeneID: 2719
NCBI-ProteinID: NP_004475
OMIM: 300037
HGNC: 4451
Ensembl: ENSG00000147257
Vega: OTTHUMG00000022448
Pharos: P51654(Tbio)
UniProt: P51654 Q53H15 I6QTG3
Position
Xq26.2
AA seq 580 aa AA seqDB search
MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGS
DLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVR
HAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYT
QLMNPGLPDSALDINECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVI
NTTDHLKFSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYI
LSLEELVNGMYRIYDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSA
YYPEDLFIDKKVLKVAHVEHEETLSSRRRELIQKLKSFISFYSALPGYICSHSPVAENDT
LCWNGQELVERYSQKAARNGMKNQFNLHELKMKGPEPVVSQIIDKLKHINQLLRTMSMPK
GRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMIKVKNQLRFLAELAYDLDVDDAPGNSQ
QATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFLVH
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaccgtgcgcaccgcgtgcttggtggtggcgatgctgctcagcttggacttc
ccgggacaggcgcagcccccgccgccgccgccggacgccacctgtcaccaagtccgctcc
ttcttccagagactgcagcccggactcaagtgggtgccagaaactcccgtgccaggatca
gatttgcaagtatgtctccctaagggcccaacatgctgctcaagaaagatggaagaaaaa
taccaactaacagcacgattgaacatggaacagctgcttcagtctgcaagtatggagctc
aagttcttaattattcagaatgctgcggttttccaagaggcctttgaaattgttgttcgc
catgccaagaactacaccaatgccatgttcaagaacaactacccaagcctgactccacaa
gcttttgagtttgtgggtgaatttttcacagatgtgtctctctacatcttgggttctgac
atcaatgtagatgacatggtcaatgaattgtttgacagcctgtttccagtcatctatacc
cagctaatgaacccaggcctgcctgattcagccttggacatcaatgagtgcctccgagga
gcaagacgtgacctgaaagtatttgggaatttccccaagcttattatgacccaggtttcc
aagtcactgcaagtcactaggatcttccttcaggctctgaatcttggaattgaagtgatc
aacacaactgatcacctgaagttcagtaaggactgtggccgaatgctcaccagaatgtgg
tactgctcttactgccagggactgatgatggttaaaccctgtggcggttactgcaatgtg
gtcatgcaaggctgtatggcaggtgtggtggagattgacaagtactggagagaatacatt
ctgtcccttgaagaacttgtgaatggcatgtacagaatctatgacatggagaacgtactg
cttggtctcttttcaacaatccatgattctatccagtatgtccagaagaatgcaggaaag
ctgaccaccactattggcaagttatgtgcccattctcaacaacgccaatatagatctgct
tattatcctgaagatctctttattgacaagaaagtattaaaagttgctcatgtagaacat
gaagaaaccttatccagccgaagaagggaactaattcagaagttgaagtctttcatcagc
ttctatagtgctttgcctggctacatctgcagccatagccctgtggcggaaaacgacacc
ctttgctggaatggacaagaactcgtggagagatacagccaaaaggcagcaaggaatgga
atgaaaaaccagttcaatctccatgagctgaaaatgaagggccctgagccagtggtcagt
caaattattgacaaactgaagcacattaaccagctcctgagaaccatgtctatgcccaaa
ggtagagttctggataaaaacctggatgaggaagggtttgaaagtggagactgcggtgat
gatgaagatgagtgcattggaggctctggtgatggaatgataaaagtgaagaatcagctc
cgcttccttgcagaactggcctatgatctggatgtggatgatgcgcctggaaacagtcag
caggcaactccgaaggacaacgagataagcacctttcacaacctcgggaacgttcattcc
ccgctgaagcttctcaccagcatggccatctcggtggtgtgcttcttcttcctggtgcac
tga

DBGET integrated database retrieval system