KEGG   Homo sapiens (human): 27190Help
Entry
27190             CDS       T01001                                 

Gene name
IL17B, IL-17B, IL-20, NIRF, ZCYTO7
Definition
(RefSeq) interleukin 17B
  KO
K05490  interleukin 17B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04657  IL-17 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    27190 (IL17B)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    27190 (IL17B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    27190 (IL17B)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   27190 (IL17B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL17
Motif
Other DBs
NCBI-GeneID: 27190
NCBI-ProteinID: NP_055258
OMIM: 604627
HGNC: 5982
Ensembl: ENSG00000127743
Vega: OTTHUMG00000130051
Pharos: Q9UHF5(Tbio)
UniProt: Q9UHF5
Position
5q32
AA seq 180 aa AA seqDB search
MDWPHNLLFLLTISIFLGLGQPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARME
EYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEAR
CLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRTGPCRQRAVMETIAVGCTCIF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggactggcctcacaacctgctgtttcttcttaccatttccatcttcctggggctgggc
cagcccaggagccccaaaagcaagaggaaggggcaagggcggcctgggcccctggcccct
ggccctcaccaggtgccactggacctggtgtcacggatgaaaccgtatgcccgcatggag
gagtatgagaggaacatcgaggagatggtggcccagctgaggaacagctcagagctggcc
cagagaaagtgtgaggtcaacttgcagctgtggatgtccaacaagaggagcctgtctccc
tggggctacagcatcaaccacgaccccagccgtatccccgtggacctgccggaggcacgg
tgcctgtgtctgggctgtgtgaaccccttcaccatgcaggaggaccgcagcatggtgagc
gtgccggtgttcagccaggttcctgtgcgccgccgcctctgcccgccaccgccccgcaca
gggccttgccgccagcgcgcagtcatggagaccatcgctgtgggctgcacctgcatcttc
tga

DBGET integrated database retrieval system