KEGG   Homo sapiens (human): 27197Help
Entry
27197             CDS       T01001                                 

Gene name
GPR82
Definition
(RefSeq) G protein-coupled receptor 82
  KO
K08420  G protein-coupled receptor 82
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    27197 (GPR82)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Other
   Orphan GPR / unclassified class A GPCRs
    27197 (GPR82)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 27197
NCBI-ProteinID: NP_543007
OMIM: 300748
HGNC: 4533
Ensembl: ENSG00000171657
Vega: OTTHUMG00000021373
Pharos: Q96P67(Tdark)
UniProt: Q96P67
Position
Xp11.4
AA seq 336 aa AA seqDB search
MNNNTTCIQPSMISSMALPIIYILLCIVGVFGNTLSQWIFLTKIGKKTSTHIYLSHLVTA
NLLVCSAMPFMSIYFLKGFQWEYQSAQCRVVNFLGTLSMHASMFVSLLILSWIAISRYAT
LMQKDSSQETTSCYEKIFYGHLLKKFRQPNFARKLCIYIWGVVLGIIIPVTVYYSVIEAT
EGEESLCYNRQMELGAMISQIAGLIGTTFIGFSFLVVLTSYYSFVSHLRKIRTCTSIMEK
DLTYSSVKRHLLVIQILLIVCFLPYSIFKPIFYVLHQRDNCQQLNYLIETKNILTCLASA
RSSTDPIIFLLLDKTFKKTLYNLFTKSNSAHMQSYG
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaatacaacatgtattcaaccatctatgatctcttccatggctttaccaatc
atttacatcctcctttgtattgttggtgtttttggaaacactctctctcaatggatattt
ttaacaaaaataggtaaaaaaacatcaacgcacatctacctgtcacaccttgtgactgca
aacttacttgtgtgcagtgccatgcctttcatgagtatctatttcctgaaaggtttccaa
tgggaatatcaatctgctcaatgcagagtggtcaattttctgggaactctatccatgcat
gcaagtatgtttgtcagtctcttaattttaagttggattgccataagccgctatgctacc
ttaatgcaaaaggattcctcgcaagagactacttcatgctatgagaaaatattttatggc
catttactgaaaaaatttcgccagcccaactttgctagaaaactatgcatttacatatgg
ggagttgtactgggcataatcattccagttaccgtatactactcagtcatagaggctaca
gaaggagaagagagcctatgctacaatcggcagatggaactaggagccatgatctctcag
attgcaggtctcattggaaccacatttattggattttcctttttagtagtactaacatca
tactactcttttgtaagccatctgagaaaaataagaacctgtacgtccattatggagaaa
gatttgacttacagttctgtgaaaagacatcttttggtcatccagattctactaatagtt
tgcttccttccttatagtatttttaaacccattttttatgttctacaccaaagagataac
tgtcagcaattgaattatttaatagaaacaaaaaacattctcacctgtcttgcttcggcc
agaagtagcacagaccccattatatttcttttattagataaaacattcaagaagacacta
tataatctctttacaaagtctaattcagcacatatgcaatcatatggttga

DBGET integrated database retrieval system