KEGG   Homo sapiens (human): 27199
Entry
27199             CDS       T01001                                 
Symbol
OXGR1, GPR80, GPR99, P2RY15, P2Y15, aKGR
Name
(RefSeq) oxoglutarate receptor 1
  KO
K08419  oxoglutarate (alpha-ketoglutarate) receptor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    27199 (OXGR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Alpha-ketoglutarate
    27199 (OXGR1)
SSDB
Motif
Pfam: 7tm_1 Sh_2 Abhydrolase_9_N
Other DBs
NCBI-GeneID: 27199
NCBI-ProteinID: NP_001333123
OMIM: 606922
HGNC: 4531
Ensembl: ENSG00000165621
Pharos: Q96P68(Tbio)
UniProt: Q96P68 B2R986
Position
13:complement(96985713..96994730)
AA seq 337 aa
MNEPLDYLANASDFPDYAAAFGNCTDENIPLKMHYLPVIYGIIFLVGFPGNAVVISTYIF
KMRPWKSSTIIMLNLACTDLLYLTSLPFLIHYYASGENWIFGDFMCKFIRFSFHFNLYSS
ILFLTCFSIFRYCVIIHPMSCFSIHKTRCAVVACAVVWIISLVAVIPMTFLITSTNRTNR
SACLDLTSSDELNTIKWYNLILTATTFCLPLVIVTLCYTTIIHTLTHGLQTDSCLKQKAR
RLTILLLLAFYVCFLPFHILRVIRIESRLLSISCSIENQIHEAYIVSRPLAALNTFGNLL
LYVVVSDNFQQAVCSTVRCKVSGNLEQAKKISYSNNP
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaatgagccactagactatttagcaaatgcttctgatttccccgattatgcagctgct
tttggaaattgcactgatgaaaacatcccactcaagatgcactacctccctgttatttat
ggcattatcttcctcgtgggatttccaggcaatgcagtagtgatatccacttacattttc
aaaatgagaccttggaagagcagcaccatcattatgctgaacctggcctgcacagatctg
ctgtatctgaccagcctccccttcctgattcactactatgccagtggcgaaaactggatc
tttggagatttcatgtgtaagtttatccgcttcagcttccatttcaacctgtatagcagc
atcctcttcctcacctgtttcagcatcttccgctactgtgtgatcattcacccaatgagc
tgcttttccattcacaaaactcgatgtgcagttgtagcctgtgctgtggtgtggatcatt
tcactggtagctgtcattccgatgaccttcttgatcacatcaaccaacaggaccaacaga
tcagcctgtctcgacctcaccagttcggatgaactcaatactattaagtggtacaacctg
attttgactgcaactactttctgcctccccttggtgatagtgacactttgctataccacg
attatccacactctgacccatggactgcaaactgacagctgccttaagcagaaagcacga
aggctaaccattctgctactccttgcattttacgtatgttttttacccttccatatcttg
agggtcattcggatcgaatctcgcctgctttcaatcagttgttccattgagaatcagatc
catgaagcttacatcgtttctagaccattagctgctctgaacacctttggtaacctgtta
ctatatgtggtggtcagcgacaactttcagcaggctgtctgctcaacagtgagatgcaaa
gtaagcgggaaccttgagcaagcaaagaaaattagttactcaaacaacccttga

DBGET integrated database retrieval system