KEGG   Homo sapiens (human): 27232Help
Entry
27232             CDS       T01001                                 

Gene name
GNMT, HEL-S-182mP
Definition
(RefSeq) glycine N-methyltransferase
  KO
K00552  glycine N-methyltransferase [EC:2.1.1.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa01100  Metabolic pathways
Disease
H00184  Hypermethioninemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    27232 (GNMT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.20  glycine N-methyltransferase
     27232 (GNMT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_31 Methyltransf_12 Methyltransf_11 Methyltransf_23 TehB Ubie_methyltran MTS PCMT TPMT CMAS Methyltransf_15
Motif
Other DBs
NCBI-GeneID: 27232
NCBI-ProteinID: NP_061833
OMIM: 606628
HGNC: 4415
Ensembl: ENSG00000124713
Vega: OTTHUMG00000014712
Pharos: Q14749(Tbio)
UniProt: Q14749 V9HW60
Structure
PDB: 

Position
6p21.1
AA seq 295 aa AA seqDB search
MVDSVYRTRSLGVAAEGLPDQYADGEAARVWQLYIGDTRSRTAEYKAWLLGLLRQHGCQR
VLDVACGTGVDSIMLVEEGFSVTSVDASDKMLKYALKERWNRRHEPAFDKWVIEEANWMT
LDKDVPQSAEGGFDAVICLGNSFAHLPDCKGDQSEHRLALKNIASMVRAGGLLVIDHRNY
DHILSTGCAPPGKNIYYKSDLTKDVTTSVLIVNNKAHMVTLDYTVQVPGAGQDGSPGLSK
FRLSYYPHCLASFTELLQAAFGGKCQHSVLGDFKPYKPGQTYIPCYFIHVLKRTD
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atggtggacagcgtgtaccggacccgctccctgggggtggcggccgaagggctcccggac
cagtacgcggacggggaggcggcgcgcgtgtggcagctgtatatcggagacacccgcagc
cgcaccgccgagtacaaggcatggctgcttgggctgctgcgccagcacggctgccagcgg
gtgctcgacgtagcctgtggcactggggtggactccattatgctggtggaagagggcttc
agtgtgacgagtgtggatgccagtgacaagatgctgaagtatgcacttaaggagcgctgg
aaccggcggcacgagcccgccttcgacaagtgggtcatcgaagaagccaactggatgact
ctggacaaagatgtgccccagtcagcagagggtggctttgatgctgtcatctgccttgga
aacagtttcgctcacttgccagactgcaaaggggaccagagtgagcaccggctggcgctg
aaaaacattgcgagcatggtgcgggcagggggcctactggtcattgatcatcgcaactac
gaccacatcctcagtacaggctgtgcacccccagggaagaacatctactataagagtgac
ttgaccaaggacgtcacaacatcagtgctgatagtgaacaacaaggcccacatggtgacc
ctggactatacggtgcaggtgccgggggctggccaggatggctctcctggcttgagtaag
ttccggctctcctactacccacactgtctggcatccttcacggagctgctccaagcagcc
ttcggaggtaagtgccagcacagcgtcctgggcgacttcaagccttacaagccaggccaa
acctacattccctgctacttcatccacgtgctcaagaggacagactga

DBGET integrated database retrieval system