KEGG   Homo sapiens (human): 27236
Entry
27236             CDS       T01001                                 
Symbol
ARFIP1, HSU52521
Name
(RefSeq) ADP ribosylation factor interacting protein 1
  KO
K20314  arfaptin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27236 (ARFIP1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Others
   Others
    27236 (ARFIP1)
SSDB
Motif
Pfam: Arfaptin
Other DBs
NCBI-GeneID: 27236
NCBI-ProteinID: NP_001020766
OMIM: 605928
HGNC: 21496
Ensembl: ENSG00000164144
Vega: OTTHUMG00000161468
Pharos: P53367(Tbio)
UniProt: P53367 B4E273 Q8N8M9
Position
4:152779954..152912357
AA seq 373 aa
MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGV
IEAGAFQGSPAPPLPSVMSPSRVAASRLAQQGSDLIVPAGGQRTQTKSGPVILADEIKNP
AMEKLELVRKWSLNTYKCTRQIISEKLGRGSRTVDLELEAQIDILRDNKKKYENILKLAQ
TLSTQLFQMVHTQRQLGDAFADLSLKSLELHEEFGYNADTQKLLAKNGETLLGAINFFIA
SVNTLVNKTIEDTLMTVKQYESARIEYDAYRTDLEELNLGPRDANTLPKIEQSQHLFQAH
KEKYDKMRNDVSVKLKFLEENKVKVLHNQLVLFHNAIAAYFAGNQKQLEQTLKQFHIKLK
TPGVDAPSWLEEQ
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggctcaagaatctcccaaaaattcagcagcagaaattccagtgactagtaatggagaa
gttgatgactctcgtgaacatagctttaatagggatttgaagcattcattaccatctgga
cttggtctctcagaaacccaaattacatctcatggctttgacaataccaaagagggtgtt
attgaagcaggagcatttcaaggttccccagcaccgccactgccatctgttatgtctcct
agcagggttgcagctagtcgactggctcagcaaggaagtgatttaattgttcctgcaggt
ggccagagaacacagacaaaaagtggaccagttattctagcagatgaaattaaaaatcct
gcaatggaaaagttagaacttgttagaaaatggagtctaaacacctataagtgtactcga
cagattatctctgagaagctaggccgtggctcaagaactgtggaccttgaacttgaagct
cagattgatatattaagggataacaagaaaaaatatgaaaatattttaaaactggctcaa
acattgtcgacccagcttttccagatggtacatacccaaaggcaacttggagatgcattt
gctgacctgagtttgaagtcactagaacttcatgaagaatttggctataatgccgatacc
cagaaactgctggctaaaaatggagagactcttcttggggccattaattttttcattgct
agtgtgaacactttggtgaataaaaccattgaagatacattaatgactgtgaaacagtat
gaaagtgccaggattgaatatgatgcatatcgcactgatttggaagaactgaatcttgga
ccacgtgacgcaaacactctgccaaagattgagcagtcacagcatctcttccaagcacat
aaggaaaaatatgataaaatgcgcaatgatgtttctgtcaaattgaaatttctagaagaa
aataaggttaaagtattgcacaatcagctggtccttttccacaatgccattgccgcttac
tttgctgggaatcagaagcagcttgaacagacacttaaacagttccatatcaaattgaaa
acccctggagtggatgccccatcttggcttgaagaacagtaa

DBGET integrated database retrieval system