KEGG   Homo sapiens (human): 27238
Entry
27238             CDS       T01001                                 

Gene name
GPKOW, GPATC5, GPATCH5, Mos2, Spp2, T54
Definition
(RefSeq) G-patch domain and KOW motifs
  KO
K13101  G patch domain and KOW motifs-containing protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    27238 (GPKOW)
Spliceosome [BR:hsa03041]
 Complex B
  U4/U6.U5 tri-snRNP components
   U4/U6.U5 tri-snRNP related factors
    27238 (GPKOW)
 Complex C
   U4/U6.U5 tri-SnRNP related factors
    27238 (GPKOW)
SSDB
Motif
Pfam: G-patch_2 KOW G-patch KN17_SH3 YajC
Other DBs
NCBI-GeneID: 27238
NCBI-ProteinID: NP_056513
OMIM: 301003
HGNC: 30677
Ensembl: ENSG00000068394
Vega: OTTHUMG00000021511
Pharos: Q92917(Tdark)
UniProt: Q92917
Position
Xp11.23
AA seq 476 aa
MADSKEGVLPLTAASTAPISFGFTRTSARRRLADSGDGAGPSPEEKDFLKTVEGRELQSV
KPQEAPKELVIPLIQNGHRRQPPARPPGPSTDTGALADGVVSQAVKELIAESKKSLEERE
NAGVDPTLAIPMIQKGCTPSGEGADSEPRAETVPEEANYEAVPVEAYGLAMLRGMGWKPG
EGIGRTFNQVVKPRVNSLRPKGLGLGANLTEAQALTPTGPSRMPRPDEEQEKDKEDQPQG
LVPGGAVVVLSGPHRGLYGKVEGLDPDNVRAMVRLAVGSRVVTVSEYYLRPVSQQEFDKN
TLDLRQQNGTASSRKTLWNQELYIQQDNSERKRKHLPDRQDGPAAKSEKAAPRSQHWLHR
DLRVRFVDNMYKGGQYYNTKMIIEDVLSPDTCVCRTDEGRVLEGLREDMLETLVPKAEGD
RVMVVLGPQTGRVGHLLSRDRARSRALVQLPRENQVVELHYDAICQYMGPSDTDDD
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggctgactccaaagagggtgttttgccgctgacggctgcttccactgccccaatttca
ttcggcttcactcgcacgtccgcacggaggcggctggccgactcgggagacggcgcgggg
ccatctccggaggagaaggatttcttgaaaaccgtggaagggagggagctgcagagtgtg
aagccccaggaggcccccaaggaactcgtcatccctttgatccagaatggccatcgcagg
cagccaccagcccggccccctgggccatccacagatactggggccttggcggatggggtg
gtgtcccaggctgtgaaggagctcattgcggaatccaagaagtctctggaagagagagag
aatgcgggtgtcgaccccacgctcgctatccccatgatccagaaaggatgcacccccagc
ggggaaggggcagacagcgaaccccgggcagagacagtgccagaggaggctaattatgag
gcggtccccgtggaggcctatgggctggccatgctgcggggcatgggctggaaacctggc
gagggcatcggccgcaccttcaatcaagtagtgaagccccgtgtcaactcactgaggccc
aaggggttagggctgggtgccaacctgaccgaggcccaggccttgacccccactggcccc
tcccgcatgccaagaccagatgaggagcaagagaaagataaggaagatcagcctcaaggg
ctggtgcctggaggagctgtggtggttctttctggccctcaccgaggcctctatgggaag
gtggaaggccttgatcctgacaatgttcgggccatggttcgtctggctgtggggagccgg
gtggtgactgttagtgagtactacctgcggcctgtctcccagcaggagtttgacaagaac
accttggatctcaggcaacagaacggaactgcctcatcacggaagaccctctggaatcaa
gaactctacatccagcaggacaactcagagaggaagcggaaacaccttccagaccgacag
gatgggcctgcagccaagagtgagaaagcagcccccagaagtcagcactggttgcacagg
gacctgcgtgtgcggtttgtggacaacatgtacaaaggaggccaatattacaacaccaag
atgataattgaagatgtcctaagcccagatacctgtgtatgtcggacagatgaaggccga
gtcctggaaggcctgagggaagacatgctggagaccctggttcccaaggcagagggtgac
cgtgtgatggtggtgctgggcccacagactggaagggtgggacatttgctgagccgggac
agagcacggagccgggctttggtgcaactgccaagagaaaatcaggtggtggagcttcac
tacgatgccatctgccagtacatgggccctagtgacacagatgatgactga

DBGET integrated database retrieval system