KEGG   Homo sapiens (human): 27239Help
Entry
27239             CDS       T01001                                 

Gene name
GPR162, A-2, GRCA
Definition
(RefSeq) G protein-coupled receptor 162
  KO
K08440  G protein-coupled receptor 162
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    27239 (GPR162)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Orphan GPCRs / unclassified GPCRs
    27239 (GPR162)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 27239
NCBI-ProteinID: NP_062832
HGNC: 16693
Ensembl: ENSG00000250510
Vega: OTTHUMG00000168368
Pharos: Q16538(Tdark)
UniProt: Q16538 A0A0I9QPQ8
Position
12p13.31
AA seq 588 aa AA seqDB search
MARGGAGAEEASLRSNALSWLACGLLALLANAWIILSISAKQQKHKPLELLLCFLAGTHI
LMAAVPLTTFAVVQLRRQASSDYDWNESICKVFVSTYYTLALATCFTVASLSYHRMWMVR
WPVNYRLSNAKKQALHAVMGIWMVSFILSTLPSIGWHNNGERYYARGCQFIVSKIGLGFG
VCFSLLLLGGIVMGLVCVAITFYQTLWARPRRARQARRVGGGGGTKAGGPGALGTRPAFE
VPAIVVEDARGKRRSSLDGSESAKTSLQVTNLVSAIVFLYDSLTGVPILVVSFFSLKSDS
APPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYA
EGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIF
STPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLR
QFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSL
GSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggctcggggcggggcgggggcagaggaggcctccctgcgctccaacgcattgtcctgg
ctggcctgtgggctcctggcgctgctggccaatgcctggatcatcctcagcatctcggcc
aagcagcagaagcacaagccactggagctgctgctctgcttcctagcgggcacacacata
ctcatggcagctgtgcccctcaccacctttgccgtggtgcagctgcgtcgtcaggcttcc
tccgactatgactggaacgagagtatctgcaaggtcttcgtgtccacctactacaccctg
gcgctggccacctgcttcacggtcgcctccctctcctaccatcgcatgtggatggtgcgc
tggcccgtcaactaccgcctcagcaacgccaagaagcaggcactgcatgccgtcatgggc
atctggatggtcagcttcatcctctccacactgccctccattggctggcacaacaacggc
gagcgctactatgcccgcggctgccagttcatagtctccaagatcggcctcggctttggc
gtttgcttcagcctcttgctacttgggggaattgtcatgggtctggtctgtgtggccatc
accttctaccagacactgtgggcccggccccggagggctcggcaggcccggagagtgggg
ggtggtggggggaccaaagcgggtgggccaggggccttgggtacccggccagcttttgag
gtaccagccattgtggtggaggatgcccgagggaagcggcggtcctcgctggatggctcg
gagtctgccaagacatccctgcaggtcaccaacttggtcagcgccatcgtctttctctat
gactcactcacaggggtgcccatcttggtggtgagcttcttctccctcaagtcggactcg
gcgcccccctggatggtgctggctgtgctgtggtgctccatggcacagacgctgctgctg
ccctccttcatctggtcctgcgagcgctaccgcgccgacgtgcgcacagtgtgggagcaa
tgcgtggccatcatgtctgaggaggatggagatgacgatgggggctgtgacgactatgca
gagggccgagtttgcaaagttcgctttgatgctaacggagccacaggaccagggagccgg
gaccccgcccaggtgaagctgctgcctggaaggcacatgctcttccctcctcttgagaga
gtccactacttacaggtccccctatcccggcgtctgtcccatgatgagacaaacatcttc
tctacccctcgggaaccaggctccttcctgcacaagtggtcatcctctgatgacatccgg
gtcctcccagcccagagccgggccctcgggggtcctcctgagtacctgggacaaagacac
aggttggaggacgaggaggacgaggaagaggctgaaggtggggggctggccagccttcgc
caattcttggagagtggggttctggggtcaggtgggggacccccacggggtcctggcttc
ttccgggaggagatcaccaccttcatcgatgagacacctctgccttctccgactgcctca
ccagggcactctcctcgtcggccccggccactgggcctctcaccccgccgactctccctt
gggtcccctgagagcagagccgttggacttcctttgggactaagcgcagggagacgctgc
tccctgacggggggtgaagaaagtgcaagggcttggggaggatcctggggcccaggcaac
cccatctttccccagctgaccctgtga

DBGET integrated database retrieval system