KEGG   Homo sapiens (human): 27242Help
Entry
27242             CDS       T01001                                 

Gene name
TNFRSF21, BM-018, CD358, DR6
Definition
(RefSeq) TNF receptor superfamily member 21
  KO
K05157  tumor necrosis factor receptor superfamily member 21
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    27242 (TNFRSF21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    27242 (TNFRSF21)
   04090 CD molecules [BR:hsa04090]
    27242 (TNFRSF21)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   27242 (TNFRSF21)
CD molecules [BR:hsa04090]
 Proteins
  27242 (TNFRSF21)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6 Death Ephrin_rec_like CARD
Motif
Other DBs
NCBI-GeneID: 27242
NCBI-ProteinID: NP_055267
OMIM: 605732
HGNC: 13469
Ensembl: ENSG00000146072
Vega: OTTHUMG00000014796
Pharos: O75509(Tbio)
UniProt: O75509 A0A024RD71
Structure
PDB: 

Position
6p12.3
AA seq 655 aa AA seqDB search
MGTSPSSSTALASCSRIARRATATMIAGSLLLLGFLSTTTAQPEQKASNLIGTYRHVDRA
TGQVLTCDKCPAGTYVSEHCTNTSLRVCSSCPVGTFTRHENGIEKCHDCSQPCPWPMIEK
LPCAALTDRECTCPPGMFQSNATCAPHTVCPVGWGVRKKGTETEDVRCKQCARGTFSDVP
SSVMKCKAYTDCLSQNLVVIKPGTKETDNVCGTLPSFSSSTSPSPGTAIFPRPEHMETHE
VPSSTYVPKGMNSTESNSSASVRPKVLSSIQEGTVPDNTSSARGKEDVNKTLPNLQVVNH
QQGPHHRHILKLLPSMEATGGEKSSTPIKGPKRGHPRQNLHKHFDINEHLPWMIVLFLLL
VLVVIVVCSIRKSSRTLKKGPRQDPSAIVEKAGLKKSMTPTQNREKWIYYCNGHGIDILK
LVAAQVGSQWKDIYQFLCNASEREVAAFSNGYTADHERAYAALQHWTIRGPEASLAQLIS
ALRQHRRNDVVEKIRGLMEDTTQLETDKLALPMSPSPLSPSPIPSPNAKLENSALLTVEP
SPQDKNKGFFVDESEPLLRCDSTSSGSSALSRNGSFITKEKKDTVLRQVRLDPCDLQPIF
DDMLHFLNPEELRVIEEIPQAEDKLDRLFEIIGVKSQEASQTLLDSVYSHLPDLL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggggacctctccgagcagcagcaccgccctcgcctcctgcagccgcatcgcccgccga
gccacagccacgatgatcgcgggctcccttctcctgcttggattccttagcaccaccaca
gctcagccagaacagaaggcctcgaatctcattggcacataccgccatgttgaccgtgcc
accggccaggtgctaacctgtgacaagtgtccagcaggaacctatgtctctgagcattgt
accaacacaagcctgcgcgtctgcagcagttgccctgtggggacctttaccaggcatgag
aatggcatagagaaatgccatgactgtagtcagccatgcccatggccaatgattgagaaa
ttaccttgtgctgccttgactgaccgagaatgcacttgcccacctggcatgttccagtct
aacgctacctgtgccccccatacggtgtgtcctgtgggttggggtgtgcggaagaaaggg
acagagactgaggatgtgcggtgtaagcagtgtgctcggggtaccttctcagatgtgcct
tctagtgtgatgaaatgcaaagcatacacagactgtctgagtcagaacctggtggtgatc
aagccggggaccaaggagacagacaacgtctgtggcacactcccgtccttctccagctcc
acctcaccttcccctggcacagccatctttccacgccctgagcacatggaaacccatgaa
gtcccttcctccacttatgttcccaaaggcatgaactcaacagaatccaactcttctgcc
tctgttagaccaaaggtactgagtagcatccaggaagggacagtccctgacaacacaagc
tcagcaagggggaaggaagacgtgaacaagaccctcccaaaccttcaggtagtcaaccac
cagcaaggcccccaccacagacacatcctgaagctgctgccgtccatggaggccactggg
ggcgagaagtccagcacgcccatcaagggccccaagaggggacatcctagacagaaccta
cacaagcattttgacatcaatgagcatttgccctggatgattgtgcttttcctgctgctg
gtgcttgtggtgattgtggtgtgcagtatccggaaaagctcgaggactctgaaaaagggg
ccccggcaggatcccagtgccattgtggaaaaggcagggctgaagaaatccatgactcca
acccagaaccgggagaaatggatctactactgcaatggccatggtatcgatatcctgaag
cttgtagcagcccaagtgggaagccagtggaaagatatctatcagtttctttgcaatgcc
agtgagagggaggttgctgctttctccaatgggtacacagccgaccacgagcgggcctac
gcagctctgcagcactggaccatccggggccccgaggccagcctcgcccagctaattagc
gccctgcgccagcaccggagaaacgatgttgtggagaagattcgtgggctgatggaagac
accacccagctggaaactgacaaactagctctcccgatgagccccagcccgcttagcccg
agccccatccccagccccaacgcgaaacttgagaattccgctctcctgacggtggagcct
tccccacaggacaagaacaagggcttcttcgtggatgagtcggagccccttctccgctgt
gactctacatccagcggctcctccgcgctgagcaggaacggttcctttattaccaaagaa
aagaaggacacagtgttgcggcaggtacgcctggacccctgtgacttgcagcctatcttt
gatgacatgctccactttctaaatcctgaggagctgcgggtgattgaagagattccccag
gctgaggacaaactagaccggctattcgaaattattggagtcaagagccaggaagccagc
cagaccctcctggactctgtttatagccatcttcctgacctgctgtag

DBGET integrated database retrieval system