KEGG   Homo sapiens (human): 27244Help
Entry
27244             CDS       T01001                                 

Gene name
SESN1, PA26, SEST1
Definition
(RefSeq) sestrin 1
  KO
K10141  sestrin 1/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04211  Longevity regulating pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    27244 (SESN1)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    27244 (SESN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PA26 CMD HTH_37
Motif
Other DBs
NCBI-GeneID: 27244
NCBI-ProteinID: NP_001186862
OMIM: 606103
HGNC: 21595
Ensembl: ENSG00000080546
Vega: OTTHUMG00000015338
Pharos: Q9Y6P5(Tbio)
UniProt: Q9Y6P5
Position
6q21
AA seq 492 aa AA seqDB search
MRLAAAANEAYTAPLAVSGLLGCKQCGGGRDQDEELGIRIPRPLGQGPSRFIPEKEILQV
GSEDAQMHALFADSFAALGRLDNITLVMVFHPQYLESFLKTQHYLLQMDGPLPLHYRHYI
GIMAAARHQCSYLVNLHVNDFLHVGGDPKWLNGLENAPQKLQNLGELNKVLAHRPWLITK
EHIEGLLKAEEHSWSLAELVHAVVLLTHYHSLASFTFGCGISPEIHCDGGHTFRPPSVSN
YCICDITNGNHSVDEMPVNSAENVSVSDSFFEVEALMEKMRQLQECRDEEEASQEEMASR
FEIEKRESMFVFSSDDEEVTPARAVSRHFEDTSYGYKDFSRHGMHVPTFRVQDYCWEDHG
YSLVNRLYPDVGQLIDEKFHIAYNLTYNTMAMHKDVDTSMLRRAIWNYIHCMFGIRYDDY
DYGEINQLLDRSFKVYIKTVVCTPEKVTKRMYDSFWRQFKHSEKVHVNLLLIEARMQAEL
LYALRAITRYMT
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttggccgccgccgcgaacgaggcgtacacggcccctttggcggtctcggggctg
ctgggctgcaagcagtgcggcgggggccgcgaccaggacgaggaacttggcattagaatt
cctcgaccactaggacagggaccaagcagattcatcccagaaaaggagatcctccaagtg
gggagtgaagacgcacagatgcatgctttatttgcagattcttttgctgctttgggccgt
ttggataacattacgttagtgatggttttccacccacaatatttagaaagtttcttaaaa
actcagcactatctactgcaaatggatgggccgttacccctacattatcgtcactacatt
ggaataatggctgcggcaagacatcagtgctcctacttagtgaacctgcatgtaaatgat
ttccttcatgttggtggggaccccaagtggctcaatggtttagagaatgctcctcaaaaa
ctacagaatttaggagaacttaacaaagtgttagcccatagaccttggcttattaccaaa
gaacacattgagggacttttaaaagctgaagagcacagctggtcccttgcggaattggta
catgcagtagttttactcacacactatcattctcttgcctcattcacattcggctgtgga
atcagtccagaaattcattgtgatggtggccacacattcagacctccttctgttagcaac
tactgcatctgtgacattacaaatggcaatcacagtgtggatgagatgccggtcaactca
gcagaaaatgtttctgtaagtgattctttctttgaggttgaagccctcatggaaaagatg
aggcagttacaggaatgtcgagatgaagaagaggcaagtcaggaagagatggcttcacgt
tttgaaatagaaaaaagagagagtatgtttgtcttctcttcagatgatgaagaagttaca
ccagcaagagctgtatctcgtcattttgaggatactagttatggctataaagatttctct
agacatgggatgcatgttccaacatttcgtgtccaggactattgctgggaagatcatggt
tattctttggtaaatcgcctttatccagatgtgggacagttgattgatgaaaaatttcac
attgcttacaatcttacttataatacaatggcaatgcacaaagatgttgatacctcaatg
cttagacgggcaatttggaactatattcactgcatgtttggaataagatatgatgattat
gactatggtgaaattaaccagctattggatcgtagctttaaagtttatatcaaaactgtt
gtttgcactcctgaaaaggttaccaaaagaatgtatgatagcttctggaggcagttcaag
cactctgagaaggttcatgttaatctgcttcttatagaagctaggatgcaagcagaactc
ctttatgctctgagagccattacccgctatatgacctga

DBGET integrated database retrieval system