KEGG   Homo sapiens (human): 27246
Entry
27246             CDS       T01001                                 
Symbol
RNF115, BCA2, RABRING7, ZFP364, ZNF364
Name
(RefSeq) ring finger protein 115
  KO
K11982  E3 ubiquitin-protein ligase RNF115/126 [EC:2.3.2.27]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27246 (RNF115)
   04121 Ubiquitin system [BR:hsa04121]
    27246 (RNF115)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     27246 (RNF115)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    27246 (RNF115)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    27246 (RNF115)
SSDB
Motif
Pfam: zf-RING_2 zf-C3HC4_2 zf-RING_11 zf-rbx1 zf-RING_UBOX zf-RING_5 zinc_ribbon_9 zf-C3HC4 zf-C3HC4_3 zf-ANAPC11 HypA DZR Prok-RING_4 zf-Nse DZR_2 zf-RING_16 Rad50_zn_hook
Other DBs
NCBI-GeneID: 27246
NCBI-ProteinID: NP_055270
OMIM: 619535
HGNC: 18154
Ensembl: ENSG00000265491
Pharos: Q9Y4L5(Tbio)
UniProt: Q9Y4L5
Position
1:complement(145738868..145824095)
AA seq 304 aa
MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGG
SRIDNTTTTHFAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPR
LPLGRRYRSRGSSRPDRSPAIEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAW
GQTGLDAIVTQLLGQLENTGPPPADKEKITSLPTVTVTQEQVDMGLECPVCKEDYTVEEE
VRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHD
RWTF
NT seq 915 nt   +upstreamnt  +downstreamnt
atggcggaggcttcggcggccggggcggactcgggcgccgctgtagccgcccaccggttt
ttctgccacttttgcaagggcgaggtcagccccaaactaccggaatatatatgtcccaga
tgtgaatcaggctttattgaagaagtgacagatgattccagttttttaggtggtggcggc
agtcggatagacaataccacaacaacacattttgcagagctttggggccatttggatcac
acgatgttttttcaagattttagaccctttctaagtagcagtccactggaccaagataat
agagccaatgaaaggggtcaccagactcacactgacttctggggagcaagacctccacgg
ttgccattgggtcggagatacagatctcgaggaagttctcgtcctgacagatctccagct
attgaaggaatactacaacacatctttgcaggattctttgcaaattctgccattcctgga
tctccacaccctttttcctggagcgggatgctgcactccaaccctggggactatgcctgg
ggtcagacagggcttgatgccattgtaacccagcttttaggacaactggaaaacacaggc
cctcccccagctgacaaggaaaagatcacatctcttccaacagtgacagtaactcaggaa
caagttgatatgggtttagagtgtccagtatgcaaagaagattacacagttgaagaggaa
gtccggcagttaccttgcaatcacttctttcacagcagttgtattgtgccgtggctagaa
ctgcatgacacatgtcctgtatgtaggaagagcttaaatggtgaggactctactcggcaa
agccagagcactgaggcctctgcaagcaacagatttagcaatgacagtcagctacatgac
cgatggactttctga

DBGET integrated database retrieval system