KEGG   Homo sapiens (human): 27248
Entry
27248             CDS       T01001                                 

Symbol
ERLEC1, C2orf30, CIM, CL24936, CL25084, HEL117, XTP3-B, XTP3TPB
Name
(RefSeq) endoplasmic reticulum lectin 1
  KO
K14008  endoplasmic reticulum lectin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    27248 (ERLEC1)
SSDB
Motif
Pfam: PRKCSH PRKCSH_1
Other DBs
NCBI-GeneID: 27248
NCBI-ProteinID: NP_056516
OMIM: 611229
HGNC: 25222
Ensembl: ENSG00000068912
Vega: OTTHUMG00000129281
Pharos: Q96DZ1(Tbio)
UniProt: Q96DZ1 V9HWD3
Position
2p16.2
AA seq 483 aa
MEEGGGGVRSLVPGGPVLLVLCGLLEASGGGRALPQLSDDIPFRVNWPGTEFSLPTTGVL
YKEDNYVIMTTAHKEKYKCILPLVTSGDEEEEKDYKGPNPRELLEPLFKQSSCSYRIESY
WTYEVCHGKHIRQYHEEKETGQKINIHEYYLGNMLAKNLLFEKEREAEEKEKSNEIPTKN
IEGQMTPYYPVGMGNGTPCSLKQNRPRSSTVMYICHPESKHEILSVAEVTTCEYEVVILT
PLLCSHPKYRFRASPVNDIFCQSLPGSPFKPLTLRQLEQQEEILRVPFRRNKEEDLQSTK
EERFPAIHKSIAIGSQPVLTVGTTHISKLTDDQLIKEFLSGSYCFRGGVGWWKYEFCYGK
HVHQYHEDKDSGKTSVVVGTWNQEEHIEWAKKNTARAYHLQDDGTQTVRMVSHFYGNGDI
CDITDKPRQVTVKLKCKESDSPHAVTVYMLEPHSCQYILGVESPVICKILDTADENGLLS
LPN
NT seq 1452 nt   +upstreamnt  +downstreamnt
atggaggaaggaggcggcggcgtacggagtctggtcccgggcgggccggtgttactggtc
ctctgcggcctcctggaggcgtccggcggcggccgagcccttcctcaactcagcgatgac
atccctttccgagtcaactggcccggcaccgagttctctctgcccacaactggagtttta
tataaagaagataattatgtcatcatgacaactgcacataaagaaaaatataaatgcata
cttccccttgtgacaagtggggatgaggaagaagaaaaggattataaaggccctaatcca
agagagcttttggagccactatttaaacaaagcagttgttcctacagaattgagtcttat
tggacttacgaagtatgtcatggaaaacacattcggcagtaccatgaagagaaagaaact
ggtcagaaaataaatattcacgagtactaccttgggaatatgttggccaagaaccttcta
tttgaaaaagaacgagaagcagaagaaaaggaaaaatcaaatgagattcccactaaaaat
atcgaaggtcagatgacaccatactatcctgtgggaatgggaaatggtacaccttgtagt
ttgaaacagaaccggcccagatcaagtactgtgatgtacatatgtcatcctgaatctaag
catgaaattctttcagtagctgaagttacaacttgtgaatatgaagttgtcattttgaca
ccactcttgtgcagtcatcctaaatataggttcagagcatctcctgtgaatgacatattt
tgtcaatcactgccaggatctccatttaagcccctcaccctgaggcagctggagcagcag
gaagaaatactaagggtgccttttaggagaaataaagaggaagatttgcaatcaactaaa
gaagagagatttccagcgatccacaagtcgattgctattggctctcagccagtgctcact
gttgggacaacccacatatccaaattgacagatgaccaactcataaaagagtttcttagt
ggttcttactgctttcgtgggggtgtcggttggtggaaatatgaattctgctatggcaaa
catgtacatcaataccatgaggacaaggatagtgggaaaacctctgtggttgtcgggaca
tggaaccaagaagagcatattgaatgggctaagaagaatactgctagagcttatcatctt
caagacgatggtacccagacagtcaggatggtgtcacatttttatggaaatggagatatt
tgtgatataactgacaaaccaagacaggtgactgtaaaactaaagtgcaaagaatcagat
tcacctcatgctgttactgtatatatgctagagcctcactcctgtcaatatattcttggg
gttgaatctccagtgatctgtaaaatcttagatacagcagatgaaaatggacttctttct
ctccccaactaa

DBGET integrated database retrieval system