KEGG   Homo sapiens (human): 27253
Entry
27253             CDS       T01001                                 
Symbol
PCDH17, PCDH68, PCH68
Name
(RefSeq) protocadherin 17
  KO
K16499  protocadherin delta 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    27253 (PCDH17)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Protocadherins
   27253 (PCDH17)
SSDB
Motif
Pfam: Cadherin Cadherin_2 Cadherin_C_2 Cadherin_4 NUC153
Other DBs
NCBI-GeneID: 27253
NCBI-ProteinID: NP_001035519
OMIM: 611760
HGNC: 14267
Ensembl: ENSG00000118946
Vega: OTTHUMG00000016992
Pharos: O14917(Tbio)
UniProt: O14917
Structure
Position
13:57630108..57729311
AA seq 1159 aa
MYLSICCCFLLWAPALTLKNLNYSVPEEQGAGTVIGNIGRDARLQPGLPPAERGGGGRSK
SGSYRVLENSAPHLLDVDADSGLLYTKQRIDRESLCRHNAKCQLSLEVFANDKEICMIKV
EIQDINDNAPSFSSDQIEMDISENAAPGTRFPLTSAHDPDAGENGLRTYLLTRDDHGLFG
LDVKSRGDGTKFPELVIQKALDREQQNHHTLVLTALDGGEPPRSATVQINVKVIDSNDNS
PVFEAPSYLVELPENAPLGTVVIDLNATDADEGPNGEVLYSFSSYVPDRVRELFSIDPKT
GLIRVKGNLDYEENGMLEIDVQARDLGPNPIPAHCKVTVKLIDRNDNAPSIGFVSVRQGA
LSEAAPPGTVIALVRVTDRDSGKNGQLQCRVLGGGGTGGGGGLGGPGGSVPFKLEENYDN
FYTVVTDRPLDRETQDEYNVTIVARDGGSPPLNSTKSFAIKILDENDNPPRFTKGLYVLQ
VHENNIPGEYLGSVLAQDPDLGQNGTVSYSILPSHIGDVSIYTYVSVNPTNGAIYALRSF
NFEQTKAFEFKVLAKDSGAPAHLESNATVRVTVLDVNDNAPVIVLPTLQNDTAELQVPRN
AGLGYLVSTVRALDSDFGESGRLTYEIVDGNDDHLFEIDPSSGEIRTLHPFWEDVTPVVE
LVVKVTDHGKPTLSAVAKLIIRSVSGSLPEGVPRVNGEQHHWDMSLPLIVTLSTISIILL
AAMITIAVKCKRENKEIRTYNCRIAEYSHPQLGGGKGKKKKINKNDIMLVQSEVEERNAM
NVMNVVSSPSLATSPMYFDYQTRLPLSSPRSEVMYLKPASNNLTVPQGHAGCHTSFTGQG
TNASETPATRMSIIQTDNFPAEPNYMGSRQQFVQSSSTFKDPERASLRDSGHGDSDQADS
DQDTNKGSCCDMSVREALKMKTTSTKSQPLEQEPEECVNCTDECRVLGHSDRCWMPQFPA
ANQAENADYRTNLFVPTVEANVETETYETVNPTGKKTFCTFGKDKREHTILIANVKPYLK
AKRALSPLLQEVPSASSSPTKACIEPCTSTKGSLDGCEAKPGALAEASSQYLPTDSQYLS
PSKQPRDPPFMASDQMARVFADVHSRASRDSSEMGAVLEQLDHPNRDLGRESVDAEEVVR
EIDKLLQDCRGNDPVAVRK
NT seq 3480 nt   +upstreamnt  +downstreamnt
atgtacctttccatctgttgctgctttcttctatgggcccctgccctcactctcaagaac
ctcaactactccgtgccggaggagcaaggggccggcacggtgatcgggaacatcggcagg
gatgctcgactgcagcctgggcttccgcctgcagagcgcggcggcggagggcgcagcaag
tcgggtagctaccgggtgctggagaactccgcaccgcacctgctggacgtggacgcagac
agcgggctcctctacaccaagcagcgcatcgaccgcgagtccctgtgccgccacaatgcc
aagtgccagctgtccctcgaggtgttcgccaacgacaaggagatctgcatgatcaaggta
gagatccaggacatcaacgacaacgcgccctccttctcctcggaccagatcgaaatggac
atctcggagaacgctgctccgggcacccgcttccccctcaccagcgcacatgaccccgac
gccggcgagaatgggctccgcacctacctgctcacgcgcgacgatcacggcctctttgga
ctggacgttaagtcccgcggcgacggcaccaagttcccagaactggtcatccagaaggct
ctggaccgcgagcaacagaatcaccatacgctcgtgctgactgccctggacggtggcgag
cctccacgttccgccaccgtacagatcaacgtgaaggtgattgactccaacgacaacagc
ccggtcttcgaggcgccatcctacttggtggaactgcccgagaacgctccgctgggtaca
gtggtcatcgatctgaacgccaccgacgccgatgaaggtcccaatggtgaagtgctctac
tctttcagcagctacgtgcctgaccgcgtgcgggagctcttctccatcgaccccaagacc
ggcctaatccgtgtgaagggcaatctggactatgaggaaaacgggatgctggagattgac
gtgcaggcccgagacctggggcctaaccctatcccagcccactgcaaagtcacggtcaag
ctcatcgaccgcaacgacaatgcgccgtccatcggtttcgtctccgtgcgccagggggcg
ctgagcgaggccgcccctcccggcaccgtcatcgccctggtgcgggtcactgaccgggac
tctggcaagaacggacagctgcagtgtcgggtcctaggcggaggagggacgggcggcggc
gggggcctgggcgggcccgggggttccgtccccttcaagcttgaggagaactacgacaac
ttctacacggtggtgactgaccgcccgctggaccgcgagacacaagacgagtacaacgtg
accatcgtggcgcgggacgggggctctcctcccctcaactccaccaagtcgttcgcgatc
aagattctagacgagaacgacaacccgcctcggttcaccaaagggctctacgtgcttcag
gtgcacgagaacaacatcccgggagagtacctgggctctgtgctcgcccaggatcccgac
ctgggccagaacggcaccgtatcctactctatcctgccctcgcacatcggcgacgtgtct
atctacacctatgtgtctgtgaatcccacgaacggggccatctacgccctgcgctccttt
aacttcgagcagaccaaggcttttgagttcaaggtgcttgctaaggactcgggggcgccc
gcgcacttggagagcaacgccacggtgagggtgacagtgctagacgtgaatgacaacgcg
ccagtgatcgtgctccccacgctgcagaacgacaccgcggagctgcaggtgccgcgcaac
gctggcctgggctatctggtgagcactgtgcgcgccctagacagcgacttcggcgagagc
gggcgtctcacctacgagatcgtggacggcaacgacgaccacctgtttgagatcgacccg
tccagcggcgagatccgcacgctgcaccctttctgggaggacgtgacgcccgtggtggag
ctggtggtgaaggtgaccgaccacggcaagcctaccctgtccgcagtggccaagctcatc
atccgctcggtgagcggatcccttcccgagggggtaccacgggtgaatggcgagcagcac
cactgggacatgtcgctgccgctcatcgtgactctgagcactatctccatcatcctccta
gcggccatgatcaccatcgccgtcaagtgcaagcgcgagaacaaggagatccgcacttac
aactgccgcatcgccgagtacagccacccgcagctgggtgggggcaagggcaagaagaag
aagatcaacaaaaatgatatcatgctggtgcagagcgaagtggaggagaggaacgccatg
aacgtcatgaacgtggtgagcagcccctccctggccacctcccccatgtacttcgactac
cagacccgcctgcccctcagctcgccccggtcggaggtgatgtatctcaaaccggcctcc
aacaacctgactgtccctcaggggcacgcgggctgccacaccagcttcaccggacaaggg
actaatgcaagcgagacccctgccactcggatgtccataattcagacagacaattttccc
gcagagcccaattacatgggcagcaggcagcagtttgttcaaagtagctccacgtttaag
gacccagaaagagccagcctgagagacagtgggcacggggacagtgatcaggctgacagt
gaccaagacactaacaaaggctcctgctgtgacatgtctgttagggaggcactcaagatg
aaaactacttcaactaaaagccaaccacttgaacaagaaccagaagagtgtgttaattgc
acagatgaatgccgagtgcttggtcattctgacaggtgctggatgccacagttccctgca
gccaatcaggctgaaaatgcagattaccgcacaaatctctttgtacctacagttgaagct
aatgttgagactgagacttacgaaactgtgaatcccactgggaaaaagactttttgtaca
tttggaaaagacaagcgagagcacactattctcattgccaacgttaaaccttatttaaaa
gccaaacgtgccctgagccctctcctccaagaggtcccctcagcatcaagcagcccaacc
aaggcgtgcatcgagccttgcacctcaacaaaaggctccctggatggctgtgaagcaaaa
ccaggagccctggctgaagcaagcagtcagtacttgcccactgacagtcaatatctgtca
cctagtaagcaaccaagagaccctcccttcatggcttccgatcagatggcaagggtcttt
gcagatgtgcattccagagccagccgggattccagtgagatgggtgctgttcttgagcag
cttgaccaccccaacagggatctgggcagagagtctgtggatgcagaggaagttgtgaga
gaaattgataagcttttgcaagactgccggggaaacgaccctgtggctgtgagaaagtga

DBGET integrated database retrieval system