KEGG   Homo sapiens (human): 27285
Entry
27285             CDS       T01001                                 
Symbol
TEKT2, TEKTB1, TEKTIN-T, h-tektin-t
Name
(RefSeq) tektin 2
  KO
K18629  tektin-2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    27285 (TEKT2)
   04812 Cytoskeleton proteins [BR:hsa04812]
    27285 (TEKT2)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Tektins
   27285 (TEKT2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Others
     27285 (TEKT2)
SSDB
Motif
Pfam: Tektin DUF725 ABC_tran_CTD Sos7 DUF948 CLZ TMF_DNA_bd TolA_bind_tri
Other DBs
NCBI-GeneID: 27285
NCBI-ProteinID: NP_055281
OMIM: 608953
HGNC: 11725
Ensembl: ENSG00000092850
UniProt: Q9UIF3
Structure
Position
1:36084094..36088275
AA seq 430 aa
MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETNNQTIWDEHDN
RTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESAEQNLQAKNLPLDVAIECLTLR
ESRRDIDVVKDPVEDELHKEVEVIEATKKALQQKVSQAFEQLCLLQEVQQQLNSDHRGKM
ETLEIDRGCLSLNLRSPNISLKVDPTRVPDGSTTLQQWDDFSRFNKDRAEAEMKAATELR
EATALTIAETNNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEEIAELQEDIRHL
EEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIAALKQKLAQAQ
DALDALCKHLARLQADIACKANSMLLDTKCMDTRRKLTVPAERFVPEVDTFTRTTNSTLS
PLKSCQLELA
NT seq 1293 nt   +upstreamnt  +downstreamnt
atggccacgctgagcgtcaagccaagtcggcgcttccagctgcccgactggcacactaac
agctacctgctatccaccaatgcccagctgcagcgagatgcttcccatcagatccgccag
gaggcccgggtgctccgcaacgagaccaacaaccagaccatttgggatgaacatgacaac
aggactcgactggtggagaggattgatactgtcaaccggtggaaggagatgctggacaag
tgtctgacagatttagatgccgagatcgatgccctgacacagatgaaggagtcagcagag
caaaacctgcaggccaagaacctgcctctggatgtggccattgagtgcctgaccctgcgg
gaaagccggcgagacattgatgtggtgaaggaccctgtggaggatgagctgcataaagag
gtggaggtcatcgaggccaccaagaaggccttgcaacagaaggtcagccaggccttcgag
cagctctgcctcttgcaggaagtccaacagcagctcaactccgaccatcggggcaaaatg
gagacactagagatcgacagaggctgtctctctctcaacctcagatccccaaacatctcg
ctgaaggttgaccccacacgtgtacctgatggctccaccacactccagcagtgggatgac
ttcagtcggttcaacaaggaccgagcggaggctgagatgaaggcagccacagagctgagg
gaggccactgctctaactattgctgagaccaacaacgagcttgaagcccagagagttgca
acggaatttgccttcaggaagcggctgcgggagatggagaaagtgtacagtgagctcaag
tggcaagagaagaataccttggaggagatcgctgagctgcaggaggacatccggcacctg
gaggaggatctgcgcacaaagctcctgagcctgaagctgtcccatacccggctagaggcc
agaacctaccggcccaacgtggaactctgccgggaccaggcacagtacggcctcaccgac
gaggttcaccagctagaggcaaccatcgctgccctgaagcagaagctggcgcaagcacag
gacgcactggacgccctgtgcaagcacctggcccggctgcaggctgacattgcctgcaag
gccaactccatgctgctggacaccaagtgcatggacacacggcgcaagctgaccgtgcct
gctgagaggttcgtgcctgaggtggacaccttcacacgtaccacaaatagcaccctgagt
ccactcaaaagctgccagctggagctggcctag

DBGET integrated database retrieval system