KEGG   Homo sapiens (human): 27289
Entry
27289             CDS       T01001                                 

Symbol
RND1, ARHS, RHO6, RHOS
Name
(RefSeq) Rho family GTPase 1
  KO
K07531  Rho family GTPase 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    27289 (RND1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    27289 (RND1)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rho Family
   Rnd [OT]
    27289 (RND1)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB Gtr1_RagA PduV-EutP
Other DBs
NCBI-GeneID: 27289
NCBI-ProteinID: NP_055285
OMIM: 609038
HGNC: 18314
Ensembl: ENSG00000172602
Vega: OTTHUMG00000170400
Pharos: Q92730(Tbio)
UniProt: Q92730
Structure
PDB: 
3Q3J 2REX 2CLS

Position
12q13.12
AA seq 232 aa
MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQR
VELSLWDTSGSPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRV
LLIGCKTDLRTDLSTLMELSHQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIF
RTASMLCLNKPSPLPQKSPVRSLSKRLLHLPSRSELISSTFKKEKAKSCSIM
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaaggagagacgggccccccagccagtcgtggccagatgtaagctcgttctggtcggg
gacgtgcagtgtgggaagaccgcgatgttgcaagtgttagcgaaggattgctatccagag
acctatgtgcccaccgtgttcgaaaattacacagcctgtttggagacagaggaacagagg
gtggagcttagtctctgggatacctcaggatctccctactacgataatgtccgtccactc
tgctacagcgactcggatgcagtattactatgttttgacatcagccgtccagagacagtg
gacagcgcactcaagaagtggaggacagaaatcctagattattgtcccagcacccgcgtt
ttgctcattggctgcaagacagacctgcgaacagacctgagtactctgatggagctgtcc
caccagaagcaggcgcccatctcctatgagcagggttgtgcaatagcaaagcagctgggt
gcagaaatctacctggaaggctcagctttcacctcagaaaagagcatccacagcatcttt
cggacggcatccatgctgtgtctgaacaagcctagcccactgccccagaagagccctgtc
cgaagcctctccaaacgactgctccacctccccagtcgctctgaactcatctcttctacc
ttcaagaaggaaaaggccaaaagctgttccattatgtga

DBGET integrated database retrieval system