KEGG   Homo sapiens (human): 2729Help
Entry
2729              CDS       T01001                                 

Gene name
GCLC, GCL, GCS, GLCL, GLCLC
Definition
(RefSeq) glutamate-cysteine ligase catalytic subunit
  KO
K11204  glutamate--cysteine ligase catalytic subunit [EC:6.3.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
hsa04216  Ferroptosis
Module
hsa_M00118  Glutathione biosynthesis, glutamate => glutathione
Disease
H00668  Anemia due to disorders of glutathione metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    2729 (GCLC)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    2729 (GCLC)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    2729 (GCLC)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.2  glutamate---cysteine ligase
     2729 (GCLC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GCS GCS2
Motif
Other DBs
NCBI-GeneID: 2729
NCBI-ProteinID: NP_001489
OMIM: 606857
HGNC: 4311
Ensembl: ENSG00000001084
Vega: OTTHUMG00000160220
Pharos: P48506(Tchem)
UniProt: P48506 Q14TF0
Position
6p12.1
AA seq 637 aa AA seqDB search
MGLLSQGSPLSWEETKRHADHVRRHGILQFLHIYHAVKDRHKDVLKWGDEVEYMLVSFDH
ENKKVRLVLSGEKVLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTV
EANMRKRRKEATSILEENQALCTITSFPRLGCPGFTLPEVKPNPVEGGASKSLFFPDEAI
NKHPRFSTLTRNIRHRRGEKVVINVPIFKDKNTPSPFIETFTEDDEASRASKPDHIYMDA
MGFGMGNCCLQVTFQACSISEARYLYDQLATICPIVMALSAASPFYRGYVSDIDCRWGVI
SASVDDRTREERGLEPLKNNNYRISKSRYDSIDSYLSKCGEKYNDIDLTIDKEIYEQLLQ
EGIDHLLAQHVAHLFIRDPLTLFEEKIHLDDANESDHFENIQSTNWQTMRFKPPPPNSDI
GWRVEFRPMEVQLTDFENSAYVVFVVLLTRVILSYKLDFLIPLSKVDENMKVAQKRDAVL
QGMFYFRKDICKGGNAVVDGCGKAQNSTELAAEEYTLMSIDTIINGKEGVFPGLIPILNS
YLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYS
LILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atggggctgctgtcccagggctcgccgctgagctgggaggaaaccaagcgccatgccgac
cacgtgcggcggcacgggatcctccagttcctgcacatctaccacgccgtcaaggaccgg
cacaaggacgttctcaagtggggcgatgaggtggaatacatgttggtatcttttgatcat
gaaaataaaaaagtccggttggtcctgtctggggagaaagttcttgaaactctgcaagag
aagggggaaaggacaaacccaaaccatcctaccctttggagaccagagtatgggagttac
atgattgaagggacaccaggacagccctacggaggaacaatgtccgagttcaatacagtt
gaggccaacatgcgaaaacgccggaaggaggctacttctatattagaagaaaatcaggct
ctttgcacaataacttcatttcccagattaggctgtcctgggttcacactgcccgaggtc
aaacccaacccagtggaaggaggagcttccaagtccctcttctttccagatgaagcaata
aacaagcaccctcgcttcagtaccttaacaagaaatatccgacataggagaggagaaaag
gttgtcatcaatgtaccaatatttaaggacaagaatacaccatctccatttatagaaaca
tttactgaggatgatgaagcttcaagggcttctaagccggatcatatttacatggatgcc
atgggatttggaatgggcaattgctgtctccaggtgacattccaagcctgcagtatatct
gaggccagatacctttatgatcagttggctactatctgtccaattgttatggctttgagt
gctgcatctcccttttaccgaggctatgtgtcagacattgattgtcgctggggagtgatt
tctgcatctgtagatgatagaactcgggaggagcgaggactggagccattgaagaacaat
aactataggatcagtaaatcccgatatgactcaatagacagctatttatctaagtgtggt
gagaaatataatgacatcgacttgacgatagataaagagatctacgaacagctgttgcag
gaaggcattgatcatctcctggcccagcatgttgctcatctctttattagagacccactg
acactgtttgaagagaaaatacacctggatgatgctaatgagtctgaccattttgagaat
attcagtccacaaattggcagacaatgagatttaagccccctcctccaaactcagacatt
ggatggagagtagaatttcgacccatggaggtgcaattaacagactttgagaactctgcc
tatgtggtgtttgtggtactgctcaccagagtgatcctttcctacaaattggattttctc
attccactgtcaaaggttgatgagaacatgaaggtagcacagaaaagagatgctgtcttg
cagggaatgttttatttcaggaaagatatttgcaaaggtggcaatgcagtggtggatggt
tgtggcaaggcccagaacagcacggagctcgctgcagaggagtacaccctcatgagcata
gacaccatcatcaatgggaaggaaggtgtgtttcctggactgatcccaattctgaactct
taccttgaaaacatggaagtggatgtggacaccagatgtagtattctgaactacctaaag
ctaattaagaagagagcatctggagaactaatgacagttgccagatggatgagggagttt
atcgcaaaccatcctgactacaagcaagacagtgtcataactgatgaaatgaattatagc
cttattttgaagtgtaaccaaattgcaaatgaattatgtgaatgcccagagttacttgga
tcagcatttaggaaagtaaaatatagtggaagtaaaactgactcatccaactag

DBGET integrated database retrieval system