KEGG   Homo sapiens (human): 27299
Entry
27299             CDS       T01001                                 

Gene name
ADAMDEC1, M12.219
Definition
(RefSeq) ADAM like decysin 1
  KO
K08634  ADAM-like, decysin 1 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    27299 (ADAMDEC1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     27299 (ADAMDEC1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   27299 (ADAMDEC1)
SSDB
Motif
Pfam: Reprolysin Pep_M12B_propep Reprolysin_5 Reprolysin_3 Reprolysin_4 Disintegrin Peptidase_M10 Peptidase_M6
Other DBs
NCBI-GeneID: 27299
NCBI-ProteinID: NP_055294
OMIM: 606393
HGNC: 16299
Ensembl: ENSG00000134028
Vega: OTTHUMG00000097858
Pharos: O15204(Tbio)
UniProt: O15204 B7Z6V5
Position
8p21.2
AA seq 470 aa
MLRGISQLPAVATMSWVLLPVLWLIVQTQAIAIKQTPELTLHEIVCPKKLHILHKREIKN
NQTEKHGKEERYEPEVQYQMILNGEEIILSLQKTKHLLGPDYTETLYSPRGEEITTKPEN
MEHCYYKGNILNEKNSVASISTCDGLRGYFTHHHQRYQIKPLKSTDEKEHAVFTSNQEEQ
DPANHTCGVKSTDGKQGPIRISRSLKSPEKEDFLRAQKYIDLYLVLDNAFYKNYNENLTL
IRSFVFDVMNLLNVIYNTIDVQVALVGMEIWSDGDKIKVVPSASTTFDNFLRWHSSNLGK
KIHDHAQLLSGISFNNRRVGLAASNSLCSPSSVAVIEAKKKNNVALVGVMSHELGHVLGM
PDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCLLQAPIPTNIMTT
PVCGNHLLEVGEDCDCGSPKECTNLCCEALTCKLKPGTDCGGDAPNHTTE
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgctgcgtgggatctcccagctacctgcagtggccaccatgtcttgggtcctgctgcct
gtactttggctcattgttcaaactcaagcaatagccataaagcaaacacctgaattaacg
ctccatgaaatagtttgtcctaaaaaacttcacattttacacaaaagagagatcaagaac
aaccagacagaaaagcatggcaaagaggaaaggtatgaacctgaagttcaatatcagatg
atcttaaatggagaagaaatcattctctccctacaaaaaaccaagcacctcctggggcca
gactacactgaaacattgtactcacccagaggagaggaaattaccacgaaacctgagaac
atggaacactgttactataaaggaaacatcctaaatgaaaagaattctgttgccagcatc
agtacttgtgacgggttgagaggatacttcacacatcatcaccaaagataccagataaaa
cctctgaaaagcacagacgagaaagaacatgccgtctttacatctaaccaggaggaacaa
gacccagctaaccacacatgtggtgtgaagagcactgacgggaaacaaggcccaattcga
atctctagatcactcaaaagcccagagaaagaagactttcttcgggcacagaaatacatt
gatctctatttggtgctggataatgccttttataagaactataatgagaatctaactctg
ataagaagctttgtgtttgatgtgatgaacctactcaatgtgatatataacaccatagat
gttcaagtggccttggtaggtatggaaatctggtctgatggggataagataaaggtggtg
cccagcgcaagcaccacgtttgacaacttcctgagatggcacagttctaacctggggaaa
aagatccacgaccatgctcagcttctcagcgggattagcttcaacaatcgacgtgtggga
ctggcagcttcaaattccttgtgttccccatcttcggttgctgttattgaggctaaaaaa
aagaataatgtggctcttgtaggagtgatgtcacatgagctgggccatgtccttggtatg
cctgatgttccattcaacaccaagtgtccctctggcagttgtgtgatgaatcagtatctg
agttcaaaattcccaaaggatttcagtacatcttgccgtgcacattttgaaagatacctt
ttatctcagaaaccaaagtgcctgctgcaagcacctattcctacaaatataatgacaaca
ccagtgtgtgggaaccaccttctagaagtgggagaagactgtgattgtggctctcctaag
gagtgtaccaatctctgctgtgaagccctaacgtgtaaactgaagcctggaactgattgc
ggaggagatgctccaaaccataccacagagtga

DBGET integrated database retrieval system