KEGG   Homo sapiens (human): 273Help
Entry
273               CDS       T01001                                 

Gene name
AMPH, AMPH1
Definition
(RefSeq) amphiphysin
  KO
K12562  amphiphysin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04666  Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    273 (AMPH)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    273 (AMPH)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    273 (AMPH)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    273 (AMPH)
  Bin/Amphiphysin/Rvs (BAR) family proteins
   N-BAR proteins
    273 (AMPH)
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    273 (AMPH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BAR SH3_9 SH3_1 SH3_2 BAR_3 HD_3 Jnk-SapK_ap_N THP2
Motif
Other DBs
NCBI-GeneID: 273
NCBI-ProteinID: NP_001626
OMIM: 600418
HGNC: 471
Ensembl: ENSG00000078053
Vega: OTTHUMG00000023725
Pharos: P49418(Tbio)
UniProt: P49418
Structure
PDB: 

Position
7p14.1
AA seq 695 aa AA seqDB search
MADIKTGIFAKNVQKRLNRAQEKVLQKLGKADETKDEQFEEYVQNFKRQEAEGTRLQREL
RGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFHQKLVDGSLLT
LDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQSSKRKDESRISKAEEEFQKAQKVF
EEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEVMTKLGDQHAD
KAFTIQGAPSDSGPLRIAKTPSPPEEPSPLPSPTASPNHTLAPASPAPARPRSPSQTRKG
PPVPPLPKVTPTKELQQENIISFFEDNFVPEISVTTPSQNEVPEVKKEETLLDLDFDPFK
PEVTPAGSAGVTHSPMSQTLPWDLWTTSTDLVQPASGGSFNGFTQPQDTSLFTMQTDQSM
ICNLAESEQAPPTEPKAEEPLAAVTPAVGLDLGMDTRAEEPVEEAVIIPGADADAAVGTL
VSAAEGAPGEEAEAEKATVPAGEGVSLEEAKIGTETTEGAESAQPEAEELEATVPQEKVI
PSVVIEPASNHEEEGENEITIGAEPKETTEDAAPPGPTSETPELATEQKPIQDPQPTPSA
PAMGAADQLASAREASQELPPGFLYKVETLHDFEAANSDELTLQRGDVVLVVPSDSEADQ
DAGWLVGVKESDWLQYRDLATYKGLFPENFTRRLD
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggccgacatcaagacgggcatcttcgccaagaacgtccagaagcgactcaaccgcgcg
caggaaaaggtcctccaaaagctggggaaagctgatgagacaaaagacgaacagttcgaa
gaatatgtccagaacttcaaacggcaagaagcagagggtaccagacttcagcgagaactc
cgaggatatttagcagcaatcaaaggcatgcaggaggcctccatgaagctcacagagtcg
ctgcatgaagtctatgagcctgactggtatgggcgggaagatgtgaaaatggttggtgag
aaatgtgatgtgctgtgggaagacttccatcaaaaactcgtggatgggtccttgctaaca
ctggatacctacctggggcaatttcctgacataaagaatcgcatcgccaagcgcagcagg
aagctagtggactatgacagtgcccgccaccatctggaagctctgcagagctccaagagg
aaggatgagagtcgaatctctaaggcagaagaagaatttcagaaagcacagaaagtgttt
gaagagtttaacgttgacttacaagaagagttaccatcattatggtcaagacgagttgga
ttttatgttaatactttcaaaaacgtctccagccttgaagccaagtttcataaggaaatt
gcggtgctttgccacaaactgtatgaagtgatgacaaaactgggtgaccagcacgccgac
aaggccttcaccatccaaggagcgcccagtgattcgggtcctctccgcattgcaaagaca
ccatcaccgcctgaggagccttcacccctcccgagcccgacagcaagtccaaatcataca
ttagcacctgcgtctcccgcaccagcacggcctcggtcaccttcacagacaaggaaaggg
cctcctgtcccacctctacctaaagtcaccccgacaaaggaactgcagcaggagaacatc
atcagtttctttgaggacaactttgttccagaaatcagtgtgacaacaccttcccagaat
gaagtccctgaggtgaagaaagaggagactttgctggatctggactttgatcctttcaag
cccgaggtgacacctgcaggttctgctggagtgacccactcacccatgtctcagacattg
ccctgggacctatggacgacaagcactgatttggtacagccggcttctggtggttcattt
aatggattcacacagccccaggatacttcattattcacaatgcagacagaccagagtatg
atctgcaacttggctgaatctgaacaggctccacccacagagccaaaagcagaggagcct
ctggctgctgtcacacctgccgttggtctggaccttggaatggacactcgggctgaggag
ccagtggaggaggcagtgatcatacctggagctgatgctgatgcagctgttggaaccttg
gtgtcagcagctgagggggccccaggagaggaagcagaggcggagaaggccactgtccct
gccggggaaggagtaagtttagaggaggccaaaattggaactgaaaccactgagggtgca
gagagtgcccaacctgaagcagaggagctcgaagcaacagtgcctcaggagaaggtcatt
ccttcggtggtcatagagcctgcctccaaccatgaagaggaaggagaaaacgaaataact
ataggtgcagagcccaaggagaccaccgaggacgcggctcctccgggccccaccagcgag
acaccggagctggctacggagcagaagcctatccaggaccctcagcccacgccttctgca
ccagccatgggggctgctgaccagctagcatctgcaagggaggcctctcaggaattgcct
cctggctttctctacaaggtggaaacactgcatgattttgaggcagcaaattctgatgaa
cttaccttacaaaggggtgatgtggtgctggtggtcccctcagattcagaagctgatcag
gatgcaggctggctggtgggagtgaaggaatcagactggcttcagtacagagaccttgcc
acctacaaaggcctctttccagagaacttcacccgacgcttagattag

DBGET integrated database retrieval system