KEGG   Homo sapiens (human): 27306Help
Entry
27306             CDS       T01001                                 

Gene name
HPGDS, GSTS, GSTS1, GSTS1-1, PGD2, PGDS
Definition
(RefSeq) hematopoietic prostaglandin D synthase
  KO
K04097  prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00590  Arachidonic acid metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    27306 (HPGDS)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    27306 (HPGDS)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    27306 (HPGDS)
   00982 Drug metabolism - cytochrome P450
    27306 (HPGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis
    27306 (HPGDS)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     27306 (HPGDS)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.2  prostaglandin-D synthase
     27306 (HPGDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_N GST_N_3 GST_C GST_N_2 GST_N_4
Motif
Other DBs
NCBI-GeneID: 27306
NCBI-ProteinID: NP_055300
OMIM: 602598
HGNC: 17890
Ensembl: ENSG00000163106
Vega: OTTHUMG00000130974
Pharos: O60760(Tchem)
UniProt: O60760 A0A384P5J0
Structure
PDB: 

Position
4q22.3
AA seq 199 aa AA seqDB search
MPNYKLTYFNMRGRAEIIRYIFAYLDIQYEDHRIEQADWPEIKSTLPFGKIPILEVDGLT
LHQSLAIARYLTKNTDLAGNTEMEQCHVDAIVDTLDDFMSCFPWAEKKQDVKEQMFNELL
TYNAPHLMQDLDTYLGGREWLIGNSVTWADFYWEICSTTLLVFKPDLLDNHPRLVTLRKK
VQAIPAVANWIKRRPQTKL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgccaaactacaaactcacttattttaatatgagggggagagcagaaattattcgttac
atatttgcttatttggacatacagtatgaagaccacagaatagaacaagctgactggcct
gaaatcaaatcaactctcccatttggaaaaatccccattttggaagttgatggacttact
cttcaccagagcctagcaatagcaagatatttgaccaaaaacacagatttggctggaaac
acagaaatggaacaatgtcatgttgatgctattgtggacactctggatgatttcatgtca
tgttttccttgggcagagaaaaagcaagatgtgaaagagcagatgttcaatgagctgctc
acgtataatgcgcctcatcttatgcaagacttggacacatatttaggggggagagaatgg
cttattggtaactctgtaacttgggcagacttctactgggagatttgcagtaccacactt
ttggtctttaagcctgacctgttagacaaccatccaaggctggtgactttacggaagaaa
gtccaagccattcctgccgtcgctaactggataaaacgaaggccccaaaccaaactctag

DBGET integrated database retrieval system