KEGG   Homo sapiens (human): 2731Help
Entry
2731              CDS       T01001                                 

Gene name
GLDC, GCE, GCSP, HYGN1
Definition
(RefSeq) glycine decarboxylase
  KO
K00281  glycine dehydrogenase [EC:1.4.4.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00260  Glycine, serine and threonine metabolism
hsa00630  Glyoxylate and dicarboxylate metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
Disease
H00191  Nonketotic hyperglycinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    2731 (GLDC)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    2731 (GLDC)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.4  With a disulfide as acceptor
    1.4.4.2  glycine dehydrogenase (aminomethyl-transferring)
     2731 (GLDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDC-P Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-GeneID: 2731
NCBI-ProteinID: NP_000161
OMIM: 238300
HGNC: 4313
Ensembl: ENSG00000178445
Vega: OTTHUMG00000019524
Pharos: P23378(Tbio)
UniProt: P23378
Position
9p24.1
AA seq 1020 aa AA seqDB search
MQSCARAWGLRLGRGVGGGRRLAGGSGPCWAPRSRDSSSGGGDSAAAGASRLLERLLPRH
DDFARRHIGPGDKDQREMLQTLGLASIDELIEKTVPANIRLKRPLKMEDPVCENEILATL
HAISSKNQIWRSYIGMGYYNCSVPQTILRNLLENSGWITQYTPYQPEVSQGRLESLLNYQ
TMVCDITGLDMANASLLDEGTAAAEALQLCYRHNKRRKFLVDPRCHPQTIAVVQTRAKYT
GVLTELKLPCEMDFSGKDVSGVLFQYPDTEGKVEDFTELVERAHQSGSLACCATDLLALC
ILRPPGEFGVDIALGSSQRFGVPLGYGGPHAAFFAVRESLVRMMPGRMVGVTRDATGKEV
YRLALQTREQHIRRDKATSNICTAQALLANMAAMFAIYHGSHGLEHIARRVHNATLILSE
GLKRAGHQLQHDLFFDTLKIQCGCSVKEVLGRAAQRQINFRLFEDGTLGISLDETVNEKD
LDDLLWIFGCESSAELVAESMGEECRGIPGSVFKRTSPFLTHQVFNSYHSETNIVRYMKK
LENKDISLVHSMIPLGSCTMKLNSSSELAPITWKEFANIHPFVPLDQAQGYQQLFRELEK
DLCELTGYDQVCFQPNSGAQGEYAGLATIRAYLNQKGEGHRTVCLIPKSAHGTNPASAHM
AGMKIQPVEVDKYGNIDAVHLKAMVDKHKENLAAIMITYPSTNGVFEENISDVCDLIHQH
GGQVYLDGANMNAQVGICRPGDFGSDVSHLNLHKTFCIPHGGGGPGMGPIGVKKHLAPFL
PNHPVISLKRNEDACPVGTVSAAPWGSSSILPISWAYIKMMGGKGLKQATETAILNANYM
AKRLETHYRILFRGARGYVGHEFILDTRPFKKSANIEAVDVAKRLQDYGFHAPTMSWPVA
GTLMVEPTESEDKAELDRFCDAMISIRQEIADIEEGRIDPRVNPLKMSPHSLTCVTSSHW
DRPYSREVAAFPLPFVKPENKFWPTIARIDDIYGDQHLVCTCPPMEVYESPFSEQKRASS
NT seq 3063 nt NT seq  +upstreamnt  +downstreamnt
atgcagtcctgtgccagggcgtgggggctgcgcctgggccgcggggtcgggggcggccgc
cgcctggctgggggatcggggccgtgctgggcgccgcggagccgggacagcagcagtggc
ggcggggacagcgccgcggctggggcctcgcgcctcctggagcgccttctgcccagacac
gacgacttcgctcggaggcacatcggccctggggacaaagaccagagagagatgctgcag
accttggggctggcgagcattgatgaattgatcgagaagacggtccctgccaacatccgt
ttgaaaagacccttgaaaatggaagaccctgtttgtgaaaatgaaatccttgcaactctg
catgccatttcaagcaaaaaccagatctggagatcgtatattggcatgggctattataac
tgctcagtgccacagacgattttgcggaacttactggagaactcaggatggatcacccag
tatactccataccagcctgaggtgtctcaggggaggctggagagtttactcaactaccag
accatggtgtgtgacatcacaggcctggacatggccaatgcatccctgctggatgagggg
actgcagccgcagaggcactgcagctgtgctacagacacaacaagaggaggaaatttctc
gttgatccccgttgccacccacagacaatagctgttgtccagactcgagccaaatatact
ggagtcctcactgagctgaagttaccctgtgaaatggacttcagtggaaaagatgtcagt
ggagtgttgttccagtacccagacacggaggggaaggtggaagactttacggaactcgtg
gagagagctcatcagagtgggagcctggcctgctgtgctactgaccttttagctttgtgc
atcttgaggccacctggagaatttggggtagacatcgccctgggcagctcccagagattt
ggagtgccactgggctatgggggaccccatgcagcattttttgctgtccgagaaagcttg
gtgagaatgatgcctggaagaatggtgggggtaacaagagatgccactgggaaagaagtg
tatcgtcttgctcttcaaaccagggagcaacacattcggagagacaaggctaccagcaac
atctgtacagctcaggccctcttggcgaatatggctgccatgtttgcaatctaccatggt
tcccatgggctggagcatattgctaggagggtacataatgccactttgattttgtcagaa
ggtctcaagcgagcagggcatcaactccagcatgacctgttctttgataccttgaagatt
cagtgtggctgctcagtgaaggaggtcttgggcagggccgctcagcggcagatcaatttt
cggctttttgaggatggcacacttggtatttctcttgatgaaacagtcaatgaaaaagat
ctggacgatttgttgtggatctttggttgtgagtcatctgcagaactggttgctgaaagc
atgggagaggagtgcagaggtattccagggtctgtgttcaagaggaccagcccgttcctc
acccatcaagtgttcaacagctaccactctgaaacaaacattgtccggtacatgaagaaa
ctggaaaataaagacatttcccttgttcacagcatgattccactgggatcctgcaccatg
aaactgaacagttcgtctgaactcgcacctatcacatggaaagaatttgcaaacatccac
ccctttgtgcctctggatcaagctcaaggatatcagcagcttttccgagagcttgagaag
gatttgtgtgaactcacaggttatgaccaggtctgtttccagccaaacagcggagcccag
ggagaatatgctggactggccactatccgagcctacttaaaccagaaaggagaggggcac
agaacggtttgcctcattccgaaatcagcacatgggaccaacccagcaagtgcccacatg
gcaggcatgaagattcagcctgtggaggtggataaatatgggaatatcgatgcagttcac
ctcaaggccatggtggataagcacaaggagaacctagcagctatcatgattacataccca
tccaccaatggggtgtttgaagagaacatcagtgacgtgtgtgacctcatccatcaacat
ggaggacaggtctacctagacggggcaaatatgaatgctcaggtgggaatctgtcgccct
ggagacttcgggtctgatgtctcgcacctaaatcttcacaagaccttctgcattccccac
ggaggaggtggtcctggcatggggcccatcggagtgaagaaacatctcgccccgtttttg
cccaatcatcccgtcatttcactaaagcggaatgaggatgcctgtcctgtgggaaccgtc
agtgcggccccatggggctccagttccatcttgcccatttcctgggcttatatcaagatg
atgggaggcaagggtcttaaacaagccacggaaactgcgatattaaatgccaactacatg
gccaagcgattagaaacacactacagaattcttttcaggggtgcaagaggttatgtgggt
catgaatttattttggacacgagacccttcaaaaagtctgcaaatattgaggctgtggat
gtggccaagagactccaggattatggatttcacgcccctaccatgtcctggcctgtggca
gggaccctcatggtggagcccactgagtcggaggacaaggcagagctggacagattctgt
gatgccatgatcagcattcggcaggaaattgctgacattgaggagggccgcatcgacccc
agggtcaatccgctgaagatgtctccacactccctgacctgcgttacatcttcccactgg
gaccggccttattccagagaggtggcagcattcccactccccttcgtgaaaccagagaac
aaattctggccaacgattgcccggattgatgacatatatggagatcagcacctggtttgt
acctgcccacccatggaagtttatgagtctccattttctgaacaaaagagggcgtcttct
tag

DBGET integrated database retrieval system