KEGG   Homo sapiens (human): 27316Help
Entry
27316             CDS       T01001                                 

Gene name
RBMX, HNRNPG, HNRPG, MRXS11, RBMXP1, RBMXRT, RNMX, hnRNP-G
Definition
(RefSeq) RNA binding motif protein X-linked
  KO
K12885  heterogeneous nuclear ribonucleoprotein G
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
Disease
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    27316 (RBMX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    27316 (RBMX)
Spliceosome [BR:hsa03041]
 Common components
  Common spliceosomal components
   hnRNP proteins
    27316 (RBMX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RBM1CTR RRM_7 RRM_5 RRM_occluded PHM7_cyt
Motif
Other DBs
NCBI-GeneID: 27316
NCBI-ProteinID: NP_002130
OMIM: 300199
HGNC: 9910
Ensembl: ENSG00000147274
Vega: OTTHUMG00000022517
Pharos: P38159(Tbio)
UniProt: P38159
Structure
PDB: 

Position
Xq26.3
AA seq 391 aa AA seqDB search
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPA
DAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTR
GPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGR
APVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
YTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGP
PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPP
RDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagcagatcgcccaggaaagctcttcattggtgggcttaatacggaaacaaat
gagaaagctcttgaagcagtatttggcaaatatggacgaatagtggaagtactcttgatg
aaagaccgtgaaaccaacaaatcaagaggatttgcttttgtcacctttgaaagcccagca
gacgctaaggatgcagccagagacatgaatggaaagtcattagatggaaaagccatcaag
gtggaacaagccaccaaaccatcatttgaaagtggtagacgtggaccgcctccacctcca
agaagtagaggccctccaagaggtcttagaggtggaagaggaggaagtggaggaaccagg
ggacctccctcacggggaggacacatggatgacggtggatattccatgaattttaacatg
agttcttccaggggaccactcccagtaaaaagaggaccaccaccaagaagtgggggtcct
cctcctaagagatctgcaccttcaggaccagttcgcagtagcagtggaatgggaggaaga
gctcctgtatcacgtggaagagatagttatggaggtccacctcgaagggaaccgctgccc
tctcgtagagatgtttatttgtccccaagagatgatgggtattctactaaagacagctat
tcaagcagagattacccaagttctcgtgatactagagattatgcaccaccaccacgagat
tatacttaccgtgattatggtcattccagttcacgtgatgactatccatcaagaggatat
agcgatagagatggatatggtcgtgatcgtgactattcagatcatccaagtggaggttcc
tacagagattcatatgagagttatggtaactcacgtagtgctccacctacacgagggccc
ccgccatcttatggtggaagcagtcgctatgatgattacagcagctcacgtgacggatat
ggtggaagtcgagacagttactcaagcagccgaagtgatctctactcaagtggtcgtgat
cgggttggcagacaagaaagagggcttcccccttctatggaaagggggtaccctcctcca
cgtgattcctacagcagttcaagccgcggagcaccaagaggtggtggccgtggaggaagc
cgatctgatagagggggaggcagaagcagatactag

DBGET integrated database retrieval system