KEGG   Homo sapiens (human): 27329
Entry
27329             CDS       T01001                                 

Gene name
ANGPTL3, ANG-5, ANGPT5, ANL3, FHBL2
Definition
(RefSeq) angiopoietin like 3
  KO
K22288  angiopoietin-like 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04979  Cholesterol metabolism
Disease
H01270  Familial hypobetalipoproteinemia
Drug target
Evinacumab: D11753
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    27329 (ANGPTL3)
SSDB
Motif
Pfam: Fibrinogen_C Crescentin DUF4201 DUF3209 ISG65-75 USP8_interact DUF1664
Other DBs
NCBI-GeneID: 27329
NCBI-ProteinID: NP_055310
OMIM: 604774
HGNC: 491
Ensembl: ENSG00000132855
Vega: OTTHUMG00000009146
Pharos: Q9Y5C1(Tbio)
UniProt: Q9Y5C1
Structure
PDB: 
6EUA

Position
1p31.3
AA seq 460 aa
MFTIKLLLFIVPLVISSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDF
VHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLEL
NSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQ
TVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHD
GIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWE
NYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTL
HLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKP
RAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFE
NT seq 1383 nt   +upstreamnt  +downstreamnt
atgttcacaattaagctccttctttttattgttcctctagttatttcctccagaattgat
caagacaattcatcatttgattctctatctccagagccaaaatcaagatttgctatgtta
gacgatgtaaaaattttagccaatggcctccttcagttgggacatggtcttaaagacttt
gtccataagacgaagggccaaattaatgacatatttcaaaaactcaacatatttgatcag
tctttttatgatctatcgctgcaaaccagtgaaatcaaagaagaagaaaaggaactgaga
agaactacatataaactacaagtcaaaaatgaagaggtaaagaatatgtcacttgaactc
aactcaaaacttgaaagcctcctagaagaaaaaattctacttcaacaaaaagtgaaatat
ttagaagagcaactaactaacttaattcaaaatcaacctgaaactccagaacacccagaa
gtaacttcacttaaaacttttgtagaaaaacaagataatagcatcaaagaccttctccag
accgtggaagaccaatataaacaattaaaccaacagcatagtcaaataaaagaaatagaa
aatcagctcagaaggactagtattcaagaacccacagaaatttctctatcttccaagcca
agagcaccaagaactactccctttcttcagttgaatgaaataagaaatgtaaaacatgat
ggcattcctgctgaatgtaccaccatttataacagaggtgaacatacaagtggcatgtat
gccatcagacccagcaactctcaagtttttcatgtctactgtgatgttatatcaggtagt
ccatggacattaattcaacatcgaatagatggatcacaaaacttcaatgaaacgtgggag
aactacaaatatggttttgggaggcttgatggagaattttggttgggcctagagaagata
tactccatagtgaagcaatctaattatgttttacgaattgagttggaagactggaaagac
aacaaacattatattgaatattctttttacttgggaaatcacgaaaccaactatacgcta
catctagttgcgattactggcaatgtccccaatgcaatcccggaaaacaaagatttggtg
ttttctacttgggatcacaaagcaaaaggacacttcaactgtccagagggttattcagga
ggctggtggtggcatgatgagtgtggagaaaacaacctaaatggtaaatataacaaacca
agagcaaaatctaagccagagaggagaagaggattatcttggaagtctcaaaatggaagg
ttatactctataaaatcaaccaaaatgttgatccatccaacagattcagaaagctttgaa
tga

DBGET integrated database retrieval system