KEGG   Homo sapiens (human): 27335Help
Entry
27335             CDS       T01001                                 

Gene name
EIF3K, ARG134, EIF3-p28, EIF3S12, HSPC029, M9, MSTP001, PLAC-24, PLAC24, PRO1474, PTD001
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit K
  KO
K15028  translation initiation factor 3 subunit K
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    27335 (EIF3K)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    27335 (EIF3K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CSN8_PSD8_EIF3K
Motif
Other DBs
NCBI-GeneID: 27335
NCBI-ProteinID: NP_037366
OMIM: 609596
HGNC: 24656
Ensembl: ENSG00000178982
Vega: OTTHUMG00000180865
Pharos: Q9UBQ5(Tbio)
UniProt: Q9UBQ5
Structure
PDB: 

Position
19q13.2
AA seq 218 aa AA seqDB search
MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAF
FQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQA
LDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWS
ADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgtttgagcagatgagagccaacgtgggcaagttgctcaagggtatcgacagg
tacaatcctgagaacctggccaccctggagcgctatgtagagacgcaggccaaggaaaat
gcctatgatctggaagccaacctggctgtcctgaagctgtaccagttcaacccagccttc
tttcagaccacggtcaccgcccagatcctgctgaaggccctcaccaacttgccgcacaca
gacttcaccctgtgcaagtgcatgatcgaccaggcacatcaagaagaacggccaatccga
cagattttgtacctcggggacctgctggagacctgccatttccaggccttctggcaagcc
ctggatgaaaacatggacctcttggaaggtataactggctttgaagactctgtccgaaag
tttatctgccatgttgtgggtatcacttaccagcacattgaccgctggctgctggccgag
atgctcggggatctgtcggacagccagctaaaggtgtggatgagcaaatacggctggagt
gccgacgagtcggggcagatcttcatctgtagccaagaagagagcattaaacccaagaac
attgtggagaagattgactttgacagtgtgtccagcatcatggcctcctcccagtaa

DBGET integrated database retrieval system