KEGG   Homo sapiens (human): 27336Help
Entry
27336             CDS       T01001                                 

Gene name
HTATSF1, TAT-SF1, TATSF1, dJ196E23.2
Definition
(RefSeq) HIV-1 Tat specific factor 1
  KO
K13093  HIV Tat-specific factor 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    27336 (HTATSF1)
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    27336 (HTATSF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7
Motif
Other DBs
NCBI-GeneID: 27336
NCBI-ProteinID: NP_001156752
OMIM: 300346
HGNC: 5276
Ensembl: ENSG00000102241
Vega: OTTHUMG00000022510
Pharos: O43719(Tbio)
UniProt: O43719
Structure
PDB: 

Position
Xq26.3
AA seq 755 aa AA seqDB search
MSGTNLDGNDEFDEQLRMQELYGDGKDGDTQTDAGGEPDSLGQQPTDTPYEWDLDKKAWF
PKITEDFIATYQANYGFSNDGASSSTANVEDVHARTAEEPPQEKAPEPTDARKKGEKRKA
ESGWFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNL
KGDGLCCYLKRESVELALKLLDEDEIRGYKLHVEVAKFQLKGEYDASKKKKKCKDYKKKL
SMQQKQLDWRPERRAGPSRMRHERVVIIKNMFHPMDFEDDPLVLNEIREDLRVECSKFGQ
IRKLLLFDRHPDGVASVSFRDPEEADYCIQTLDGRWFGGRQITAQAWDGTTDYQVEETSR
EREERLRGWEAFLNAPEANRGLRRSDSVSASERAGPSRARHFSEHPSTSKMNAQETATGM
AFEEPIDEKKFEKTEDGGEFEEGASENNAKESSPEKEAEEGCPEKESEEGCPKRGFEGSC
SQKESEEGNPVRGSEEDSPKKESKKKTLKNDCEENGLAKESEDDLNKESEEEVGPTKESE
EDDSEKESDEDCSEKQSEDGSEREFEENGLEKDLDEEGSEKELHENVLDKELEENDSENS
EFEDDGSEKVLDEEGSEREFDEDSDEKEEEEDTYEKVFDDESDEKEDEEYADEKGLEAAD
KKAEEGDADEKLFEESDDKEDEDADGKEVEDADEKLFEDDDSNEKLFDEEEDSSEKLFDD
SDERGTLGGFGSVEEGPLSTGSSFILSSDDDDDDI
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcaccaacttggatgggaacgatgagtttgatgagcagttgcgaatgcaagaa
ttgtacggagacggcaaggatggtgacacccagaccgatgccggcggagaacccgattct
ctcgggcagcagccgacggacactccctacgagtgggacctggacaaaaaggcttggttc
cccaagattactgaagatttcattgctacatatcaggccaattatggcttctctaacgat
ggcgcatctagttctaccgcaaatgttgaagatgtccatgctaggactgcagaggaacct
ccacaagaaaaagccccggaacccactgatgccagaaagaagggagaaaaaagaaaggct
gagtcaggatggtttcatgttgaagaagacagaaatacaaatgtatacgtgtctggtttg
cctccagatattacagtggatgaatttatacaacttatgtccaagtttggcattattatg
agagatcctcagacagaagaatttaaggtcaaactttacaaagataatcaaggaaatctt
aaaggagacggtctttgctgttatttgaaaagagaatctgtggaacttgcattaaaactt
ttggatgaagatgaaattagaggctacaaattacatgttgaggtggcaaagtttcaactg
aagggagaatatgatgcctcaaagaagaagaagaagtgcaaagactataagaagaagctg
tctatgcaacaaaagcagttggattggagacctgagaggcgagccggaccatcccggatg
cgccatgagcgagttgtcatcatcaagaatatgtttcatcctatggattttgaggatgat
ccgttggtgctgaatgagatcagagaagaccttcgagtagagtgttcgaagtttggacaa
attaggaaactccttctctttgataggcacccagatggtgtggcctctgtgtcctttcgg
gatccagaggaagctgattattgtattcagactctcgatggaagatggtttggtggccgt
caaatcactgcccaggcatgggatgggactacagattatcaggtggaggaaacctcaaga
gaaagggaggaaaggctgagaggatgggaggctttcctcaatgctcctgaggccaacaga
ggccttaggcgttcagattctgtctctgcttccgaaagggcagggccttctagagcaagg
catttttcagagcaccccagcacatctaaaatgaatgctcaagaaactgcaactggaatg
gcgtttgaagaacctatagatgagaagaagtttgaaaagacagaagatgggggagaattt
gaagaaggtgcttctgaaaacaatgctaaggaaagtagccccgaaaaagaggctgaagaa
ggctgccctgaaaaagaatctgaagagggctgccccaaaagagggtttgaaggcagctgc
tcccaaaaagagtctgaagaaggcaatcccgtaagaggatctgaagaggatagtcctaaa
aaagagtctaaaaagaagacactcaaaaatgattgtgaagagaatggccttgcaaaggaa
tctgaagatgacctcaacaaggagtctgaagaggaggttggccccacaaaagagtccgaa
gaagatgactcagagaaagagtctgatgaagactgctctgaaaaacagtctgaagatggc
tccgaaagagaatttgaagaaaatggtctcgagaaagatttggacgaggaaggttctgaa
aaggagcttcatgaaaatgttcttgacaaagagttagaagaaaatgactctgaaaactcc
gaatttgaagatgacggctctgaaaaagtgttagatgaggaaggctctgagagagagttt
gacgaagattcagatgaaaaggaagaagaggaggatacatatgaaaaagtatttgatgat
gagtctgatgagaaagaggatgaagaatatgcagatgaaaaggggcttgaagctgctgat
aaaaaggcggaagaaggtgatgcagatgaaaagctgtttgaagagtcagatgacaaggaa
gatgaagatgcagatggaaaggaagttgaagatgctgacgaaaagttgttcgaagatgat
gattccaatgagaagttgtttgatgaggaggaagattccagtgagaagttgtttgacgat
tctgatgagagggggactttgggtggttttgggagtgttgaagaagggcccctatccact
ggcagcagctttattctcagtagcgatgatgatgacgatgatatttaa

DBGET integrated database retrieval system