KEGG   Homo sapiens (human): 27343Help
Entry
27343             CDS       T01001                                 

Gene name
POLL, BETAN, POLKAPPA
Definition
(RefSeq) DNA polymerase lambda
  KO
K03512  DNA polymerase lambda [EC:2.7.7.7 4.2.99.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    27343 (POLL)
   03450 Non-homologous end-joining
    27343 (POLL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    27343 (POLL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     27343 (POLL)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.-  
     27343 (POLL)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     27343 (POLL)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    X-family DNA polymerases
     27343 (POLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_B_palm DNA_pol_B_thumb DNA_pol_lambd_f HHH_8 HHH_5 BRCT_2 NTP_transf_2 HHH HHH_2 BRCT
Motif
Other DBs
NCBI-GeneID: 27343
NCBI-ProteinID: NP_001167555
OMIM: 606343
HGNC: 9184
Ensembl: ENSG00000166169
Vega: OTTHUMG00000018933
Pharos: Q9UGP5(Tbio)
UniProt: Q9UGP5
Structure
PDB: 

Position
10q24.32
AA seq 575 aa AA seqDB search
MDPRGILKAFPKRQKIHADASSKVLAKIPRREEGEEAEEWLSSLRAHVVRTGIGRARAEL
FEKQIVQHGGQLCPAQGPGVTHIVVDEGMDYERALRLLRLPQLPPGAQLVKSAWLSLCLQ
ERRLVDVAGFSIFIPSRYLDHPQPSKAEQDASIPPGTHEALLQTALSPPPPPTRPVSPPQ
KAKEAPNTQAQPISDDEASDGEETQVSAADLEALISGHYPTSLEGDCEPSPAPAVLDKWV
CAQPSSQKATNHNLHITEKLEVLAKAYSVQGDKWRALGYAKAINALKSFHKPVTSYQEAC
SIPGIGKRMAEKIIEILESGHLRKLDHISESVPVLELFSNIWGAGTKTAQMWYQQGFRSL
EDIRSQASLTTQQAIGLKHYSDFLERMPREEATEIEQTVQKAAQAFNSGLLCVACGSYRR
GKATCGDVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGVCRLP
GPGRRHRRLDIIVVPYSEFACALLYFTGSAHFNRSMRALAKTKGMSLSEHALSTAVVRNT
HGCKVGPGRVLPTPTEKDVFRLLGLPYREPAERDW
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaggggtatcttgaaggcatttcccaagcggcagaaaattcatgctgatgca
tcatcaaaagtacttgcaaagattcctaggagggaagagggagaagaagcagaagagtgg
ctgagctcccttcgggcccatgttgtgcgcactggcattggacgagcccgggcagaactc
tttgagaagcagattgttcagcatggcggccagctatgccctgcccagggcccaggtgtc
actcacattgtggtggatgaaggcatggactatgagcgagccctccgccttctcagacta
ccccagctgcccccgggtgctcagctggtgaagtcagcctggctgagcttgtgccttcag
gagaggaggctggtggatgtagctggattcagcatcttcatccccagtaggtacttggac
catccacagcccagcaaggcagagcaggatgcttctattcctcctggcacccatgaggcc
ctgcttcagacagccctttctcctcctcctcctcccaccaggcctgtgtctcctccccaa
aaggcaaaagaggcaccaaacacccaagcccagcccatctctgatgatgaagccagtgat
ggggaagaaacccaggttagtgcagctgatctggaagccctcatcagtggccactacccc
acctcccttgagggagattgtgagcctagcccagcccctgctgtcctggataagtgggtc
tgtgcacagccctcaagccagaaggcgaccaatcacaacctccatatcacagagaagctg
gaagttctggccaaagcctacagtgttcagggagacaagtggagggccctgggctatgcc
aaggccatcaatgccctcaagagcttccataagcctgtcacctcgtaccaggaggcctgc
agtatccctgggattgggaagcggatggctgagaaaatcatagagatcctggagagcggg
catttgcggaagctggaccatatcagtgagagcgtgcctgtcttggagctcttctccaac
atctggggagctgggaccaagactgcccagatgtggtaccaacagggcttccgaagtctg
gaagacatccgcagccaggcctccctgacaacccagcaggccatcggcctgaagcattac
agtgacttcctggaacgtatgcccagggaggaggctacagagattgagcagacagtccag
aaagcagcccaggcctttaactctgggctgctgtgtgtggcatgtggttcataccgacgg
ggaaaggcgacctgtggtgatgtcgacgtgctcatcactcacccagatggccggtcccac
cggggtatcttcagccgcctccttgacagtcttcggcaggaagggttcctcacagatgac
ttggtgagccaagaggagaatggtcagcaacagaagtacttgggggtgtgccggctccca
gggccagggcggcggcaccggcgcctggacatcatcgtggtgccctatagcgagtttgcc
tgtgccctgctctacttcaccggctctgcacacttcaaccgctccatgcgagccctggcc
aaaaccaagggcatgagtctgtcagaacatgccctcagcactgctgtggtccggaacacc
catggctgcaaggtggggcctggccgagtgctgcccactcccactgagaaggatgtcttc
aggctcttaggcctcccctaccgagaacctgctgagcgggactggtga

DBGET integrated database retrieval system