KEGG   Homo sapiens (human): 27344
Entry
27344             CDS       T01001                                 

Gene name
PCSK1N, BigLEN, PEN, PROSAAS, SAAS, SCG8, SgVIII
Definition
(RefSeq) proprotein convertase subtilisin/kexin type 1 inhibitor
  KO
K23596  proSAAS
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    27344 (PCSK1N)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I49: proSAAS family
   27344 (PCSK1N)
SSDB
Motif
Pfam: ProSAAS
Other DBs
NCBI-GeneID: 27344
NCBI-ProteinID: NP_037403
OMIM: 300399
HGNC: 17301
Ensembl: ENSG00000102109
Vega: OTTHUMG00000034502
Pharos: Q9UHG2(Tbio)
UniProt: Q9UHG2
Position
Xp11.23
AA seq 260 aa
MAGSPLLWGPRAGGVGLLVLLLLGLFRPPPALCARPVKEPRGLSAASPPLAETGAPRRFR
RSVPRGEAAGAVQELARALAHLLEAERQERARAEAQEAEDQQARVLAQLLRVWGAPRNSD
PALGLDDDPDAPAAQLARALLRARLDPAALAAQLVPAPVPAAALRPRPPVYDDGPAGPDA
EEAGDETPDVDPELLRYLLGRILAGSADSEGVAAPRRLRRAADHDVGSELPPEGVLGALL
RVKRLETPAPQVPARRLLPP
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcggggtcgccgctgctctgggggccgcgggccgggggcgtcggccttttggtgctg
ctgctgctcggcctgtttcggccgccccccgcgctctgcgcgcggccggtaaaggagccc
cgcggcctaagcgcagcgtctccgcccttggctgagactggcgctcctcgccgcttccgg
cggtcagtgccccgaggtgaggcggcgggggcggtgcaggagctggcgcgggcgctggcg
catctgctggaggccgaacgtcaggagcgggcgcgggccgaggcgcaggaggctgaggat
cagcaggcgcgcgtcctggcgcagctgctgcgcgtctggggcgccccccgcaactctgat
ccggctctgggcctggacgacgaccccgacgcgcctgcagcgcagctcgctcgcgctctg
ctccgcgcccgccttgaccctgccgccctagcagcccagcttgtccccgcgcccgtcccc
gccgcggcgctccgaccccggcccccggtctacgacgacggccccgcgggcccggatgct
gaggaggcaggcgacgagacacccgacgtggaccccgagctgttgaggtacttgctggga
cggattcttgcgggaagcgcggactccgagggggtggcagccccgcgccgcctccgccgt
gccgccgaccacgatgtgggctctgagctgccccctgagggcgtgctgggggcgctgctg
cgtgtgaaacgcctagagaccccggcgccccaggtgcctgcacgccgcctcttgccaccc
tga

DBGET integrated database retrieval system