KEGG   Homo sapiens (human): 27347Help
Entry
27347             CDS       T01001                                 

Gene name
STK39, DCHT, PASK, SPAK
Definition
(RefSeq) serine/threonine kinase 39
  KO
K08835  serine/threonine-protein kinase OSR1/STK39 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    27347 (STK39)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     27347 (STK39)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: STE group
  STE20 family
   27347 (STK39)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Kinase-like Pkinase_fungal APH Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 27347
NCBI-ProteinID: NP_037365
OMIM: 607648
HGNC: 17717
Ensembl: ENSG00000198648
Vega: OTTHUMG00000133745
Pharos: Q9UEW8(Tbio)
UniProt: Q9UEW8
Position
2q24.3
AA seq 545 aa AA seqDB search
MAEPSGSPVHVQLPQQAAPVTAAAAAAPAAATAAPAPAAPAAPAPAPAPAAQAVGWPICR
DAYELQEVIGSGATAVVQAALCKPRQERVAIKRINLEKCQTSMDELLKEIQAMSQCSHPN
VVTYYTSFVVKDELWLVMKLLSGGSMLDIIKYIVNRGEHKNGVLEEAIIATILKEVLEGL
DYLHRNGQIHRDLKAGNILLGEDGSVQIADFGVSAFLATGGDVTRNKVRKTFVGTPCWMA
PEVMEQVRGYDFKADMWSFGITAIELATGAAPYHKYPPMKVLMLTLQNDPPTLETGVEDK
EMMKKYGKSFRKLLSLCLQKDPSKRPTAAELLKCKFFQKAKNREYLIEKLLTRTPDIAQR
AKKVRRVPGSSGHLHKTEDGDWEWSDDEMDEKSEEGKAAFSQEKSRRVKEENPEIAVSAS
TIPEQIQSLSVHDSQGPPNANEDYREASSCAVNLVLRLRNSRKELNDIRFEFTPGRDTAD
GVSQELFSAGLVDGHDVVIVAANLQKIVDDPKALKTLTFKLASGCDGSEIPDEVKLIGFA
QLSVS
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccgagcggctcgcccgtgcacgtccagcttccccagcaggcggccccggtg
acagcggcggcggcggcggccccggcggccgcgacagcagcgccggccccggcagctccc
gcggccccggccccggccccggccccggcggcacaggctgtcggctggcccatctgcagg
gacgcgtacgagctgcaggaggttatcggcagtggagctactgctgtggttcaggcagcc
ctatgcaaacccaggcaagaacgtgtagcaataaaacggatcaacttggaaaaatgccag
accagtatggatgaactattaaaagaaattcaagccatgagtcagtgcagccatcccaac
gtagtgacctattacacctcttttgtggtcaaagatgaactttggctggtcatgaaatta
ctaagtggaggttcaatgttggatatcataaaatacattgtcaaccgaggagaacacaag
aatggagttctggaagaggcaataatagcaacaattcttaaagaggttttggaaggctta
gactatctacacagaaacggtcagattcacagggatttgaaagctggtaatattcttctg
ggtgaggatggttcagtacaaatagcagattttggggtaagtgcgttcctagcaacaggg
ggtgatgttacccgaaataaagtaagaaaaacattcgttggcaccccatgttggatggct
cctgaagtcatggaacaggtgagaggctatgacttcaaggctgacatgtggagttttgga
ataactgccattgaattagcaacaggagcagcgccttatcacaaatatcctcccatgaaa
gtgttaatgttgactttgcaaaatgatccacccactttggaaacaggggtagaggataaa
gaaatgatgaaaaagtacggcaagtcctttagaaaattactttcactgtgtcttcagaaa
gatccttccaaaaggcccacagcagcagaacttttaaaatgcaaattcttccagaaagcc
aagaacagagagtacctgattgagaagctgcttacaagaacaccagacatagcccaaaga
gccaaaaaggtaagaagagttcctgggtcaagtggtcaccttcataaaaccgaagacggg
gactgggagtggagtgacgacgagatggatgagaagagcgaagaagggaaagcagctttt
tctcaggaaaagtcacgaagagtaaaagaagaaaatccagagattgcagtgagtgccagc
accatccccgaacaaatacagtccctctctgtgcacgactctcagggcccacccaatgct
aatgaagactacagagaagcttcttcttgtgccgtgaacctcgttttgagattaagaaac
tccagaaaggaacttaatgacatacgatttgagtttactccaggaagagatacagcagat
ggtgtatctcaggagctcttctctgctggcttggtggatggtcacgatgtagttatagtg
gctgctaatttacagaagattgtagatgatcccaaagctttaaaaacattgacatttaag
ttggcttctggctgtgatgggtcggagattcctgatgaagtgaagctgattgggtttgct
cagttgagtgtcagctga

DBGET integrated database retrieval system