KEGG   Homo sapiens (human): 27349
Entry
27349             CDS       T01001                                 

Gene name
MCAT, FASN2C, MCT, MCT1, MT, NET62, fabD
Definition
(RefSeq) malonyl-CoA-acyl carrier protein transacylase
  KO
K00645  [acyl-carrier-protein] S-malonyltransferase [EC:2.3.1.39]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
Module
hsa_M00082  Fatty acid biosynthesis, initiation
hsa_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    27349 (MCAT)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    27349 (MCAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    27349 (MCAT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.39  [acyl-carrier-protein] S-malonyltransferase
     27349 (MCAT)
Lipid biosynthesis proteins [BR:hsa01004]
 Fatty acid synthase
  Component type
   27349 (MCAT)
SSDB
Motif
Pfam: Acyl_transf_1
Other DBs
NCBI-GeneID: 27349
NCBI-ProteinID: NP_775738
OMIM: 614479
HGNC: 29622
Ensembl: ENSG00000100294
Vega: OTTHUMG00000150704
Pharos: Q8IVS2(Tbio)
UniProt: Q8IVS2
Structure
PDB: 
2C2N

Position
22q13.2
AA seq 390 aa
MSVRVARVAWVRGLGASYRRGASSFPVPPPGAQGVAELLRDATGAEEEAPWAATERRMPG
QCSVLLFPGQGSQVVGMGRGLLNYPRVRELYAAARRVLGYDLLELSLHGPQETLDRTVHC
QPAIFVASLAAVEKLHHLQPSVIENCVAAAGFSVGEFAALVFAGAMEFAEGLYAVKIRAE
AMQEASEAVPSGMLSVLGQPQSKFNFACLEAREHCKSLGIENPVCEVSNYLFPDCRVISG
HQEALRFLQKNSSKFHFRRTRMLPVSGAFHTRLMEPAVEPLTQALKAVDIKKPLVSVYSN
VHAHRYRHPGHIHKLLAQQLVSPVKWEQTMHAIYERKKGRGFPQTFEVGPGRQLGAILKS
CNMQAWKSYSAVDVLQTLEHVDLDPQEPPR
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgagcgtccgggtcgcacgggtagcgtgggtcaggggcttgggcgccagctaccgccgc
ggcgcctcgagcttcccggtgcctccgccgggcgcccagggtgtagcggagctgctgcga
gatgcgaccggggcggaggaggaggcgccctgggcggcgacggagcggcgaatgccgggc
cagtgctccgtgctgctcttcccgggccagggcagccaggtggtgggcatgggccgcggt
ctgctcaactacccgcgcgtccgcgaactctacgccgccgcccgccgcgtgctgggctac
gacctgctggaactgagcctgcacgggccgcaggagaccctggaccgcaccgtgcactgt
cagcccgcgatcttcgtggcatcgctggccgctgtcgagaaactacatcacctgcagccc
tcggtgattgagaactgtgttgctgctgctggattcagtgtgggagagtttgcagcccta
gtgtttgccggagccatggaatttgctgaaggtttgtatgcagtgaaaatccgagctgag
gccatgcaggaagcttcagaagctgtccccagtgggatgctgtctgtcctcggccagcct
cagtccaagttcaacttcgcctgtttggaagcccgggaacactgcaagtctttaggcata
gagaaccccgtatgtgaagtgtccaactacctctttccagattgcagggtgatttcagga
caccaagaggctctacggtttctccagaagaattcctctaagtttcatttcagacgcacc
aggatgttgccggttagtggcgcattccacacccgcctcatggagccagccgtggagccc
ctgacgcaagctttaaaggcagtcgacattaagaagcctctggtttctgtctactccaac
gtccacgcgcatagatacaggcatcccgggcacatccacaagctgctggcccagcagctg
gtctccccagtgaagtgggagcagacgatgcatgccatatacgaaaggaaaaagggcagg
gggttcccccaaactttcgaagtaggccctggcaggcagctgggagccatcctgaagagc
tgtaacatgcaggcctggaagtcctacagcgccgtggatgtgctgcagaccctcgaacat
gtggacctggaccctcaggagcccccgagatga

DBGET integrated database retrieval system