KEGG   Homo sapiens (human): 2735Help
Entry
2735              CDS       T01001                                 

Gene name
GLI1, GLI, PAPA8, PPD1
Definition
(RefSeq) GLI family zinc finger 1
  KO
K16797  zinc finger protein GLI1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Module
hsa_M00678  Hedgehog signaling
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    2735 (GLI1)
   04024 cAMP signaling pathway
    2735 (GLI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2735 (GLI1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    2735 (GLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2735 (GLI1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    2735 (GLI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 FOXP-CC zf-C2H2_4 IL17
Motif
Other DBs
NCBI-GeneID: 2735
NCBI-ProteinID: NP_005260
OMIM: 165220
HGNC: 4317
Ensembl: ENSG00000111087
Vega: OTTHUMG00000167332
Pharos: P08151(Tchem)
UniProt: P08151
Structure
PDB: 

Position
12q13.3
AA seq 1106 aa AA seqDB search
MFNSMTPPPISSYGEPCCLRPLPSQGAPSVGTEGLSGPPFCHQANLMSGPHSYGPARETN
SCTEGPLFSSPRSAVKLTKKRALSISPLSDASLDLQTVIRTSPSSLVAFINSRCTSPGGS
YGHLSIGTMSPSLGFPAQMNHQKGPSPSFGVQPCGPHDSARGGMIPHPQSRGPFPTCQLK
SELDMLVGKCREEPLEGDMSSPNSTGIQDPLLGMLDGREDLEREEKREPESVYETDCRWD
GCSQEFDSQEQLVHHINSEHIHGERKEFVCHWGGCSRELRPFKAQYMLVVHMRRHTGEKP
HKCTFEGCRKSYSRLENLKTHLRSHTGEKPYMCEHEGCSKAFSNASDRAKHQNRTHSNEK
PYVCKLPGCTKRYTDPSSLRKHVKTVHGPDAHVTKRHRGDGPLPRAPSISTVEPKREREG
GPIREESRLTVPEGAMKPQPSPGAQSSCSSDHSPAGSAANTDSGVEMTGNAGGSTEDLSS
LDEGPCIAGTGLSTLRRLENLRLDQLHQLRPIGTRGLKLPSLSHTGTTVSRRVGPPVSLE
RRSSSSSSISSAYTVSRRSSLASPFPPGSPPENGASSLPGLMPAQHYLLRARYASARGGG
TSPTAASSLDRIGGLPMPPWRSRAEYPGYNPNAGVTRRASDPAQAADRPAPARVQRFKSL
GCVHTPPTVAGGGQNFDPYLPTSVYSPQPPSITENAAMDARGLQEEPEVGTSMVGSGLNP
YMDFPPTDTLGYGGPEGAAAEPYGARGPGSLPLGPGPPTNYGPNPCPQQASYPDPTQETW
GEFPSHSGLYPGPKALGGTYSQCPRLEHYGQVQVKPEQGCPVGSDSTGLAPCLNAHPSEG
PPHPQPLFSHYPQPSPPQYLQSGPYTQPPPDYLPSEPRPCLDFDSPTHSTGQLKAQLVCN
YVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHK
SGSYPTPSPCHENFVVGANRASHRAAAPPRLLPPLPTCYGPLKVGGTNPSCGHPEVGRLG
GGPALYPPPEGQVCNPLDSLDLDNTQLDFVAILDEPQGLSPPPSHDQRGSSGHTPPPSGP
PNMAVGNMSVLLRSLPGETEFLNSSA
NT seq 3321 nt NT seq  +upstreamnt  +downstreamnt
atgttcaactcgatgaccccaccaccaatcagtagctatggcgagccctgctgtctccgg
cccctccccagtcagggggcccccagtgtggggacagaaggactgtctggcccgcccttc
tgccaccaagctaacctcatgtccggcccccacagttatgggccagccagagagaccaac
agctgcaccgagggcccactcttttcttctccccggagtgcagtcaagttgaccaagaag
cgggcactgtccatctcacctctgtcggatgccagcctggacctgcagacggttatccgc
acctcacccagctccctcgtagctttcatcaactcgcgatgcacatctccaggaggctcc
tacggtcatctctccattggcaccatgagcccatctctgggattcccagcccagatgaat
caccaaaaagggccctcgccttcctttggggtccagccttgtggtccccatgactctgcc
cggggtgggatgatcccacatcctcagtcccggggacccttcccaacttgccagctgaag
tctgagctggacatgctggttggcaagtgccgggaggaacccttggaaggtgatatgtcc
agccccaactccacaggcatacaggatcccctgttggggatgctggatgggcgggaggac
ctcgagagagaggagaagcgtgagcctgaatctgtgtatgaaactgactgccgttgggat
ggctgcagccaggaatttgactcccaagagcagctggtgcaccacatcaacagcgagcac
atccacggggagcggaaggagttcgtgtgccactgggggggctgctccagggagctgagg
cccttcaaagcccagtacatgctggtggttcacatgcgcagacacactggcgagaagcca
cacaagtgcacgtttgaagggtgccggaagtcatactcacgcctcgaaaacctgaagacg
cacctgcggtcacacacgggtgagaagccatacatgtgtgagcacgagggctgcagtaaa
gccttcagcaatgccagtgaccgagccaagcaccagaatcggacccattccaatgagaag
ccgtatgtatgtaagctccctggctgcaccaaacgctatacagatcctagctcgctgcga
aaacatgtcaagacagtgcatggtcctgacgcccatgtgaccaaacggcaccgtggggat
ggccccctgcctcgggcaccatccatttctacagtggagcccaagagggagcgggaagga
ggtcccatcagggaggaaagcagactgactgtgccagagggtgccatgaagccacagcca
agccctggggcccagtcatcctgcagcagtgaccactccccggcagggagtgcagccaat
acagacagtggtgtggaaatgactggcaatgcagggggcagcactgaagacctctccagc
ttggacgagggaccttgcattgctggcactggtctgtccactcttcgccgccttgagaac
ctcaggctggaccagctacatcaactccggccaatagggacccggggtctcaaactgccc
agcttgtcccacaccggtaccactgtgtcccgccgcgtgggccccccagtctctcttgaa
cgccgcagcagcagctccagcagcatcagctctgcctatactgtcagccgccgctcctcc
ctggcctctcctttcccccctggctccccaccagagaatggagcatcctccctgcctggc
cttatgcctgcccagcactacctgcttcgggcaagatatgcttcagccagagggggtggt
acttcgcccactgcagcatccagcctggatcggataggtggtcttcccatgcctccttgg
agaagccgagccgagtatccaggatacaaccccaatgcaggggtcacccggagggccagt
gacccagcccaggctgctgaccgtcctgctccagctagagtccagaggttcaagagcctg
ggctgtgtccataccccacccactgtggcagggggaggacagaactttgatccttacctc
ccaacctctgtctactcaccacagccccccagcatcactgagaatgctgccatggatgct
agagggctacaggaagagccagaagttgggacctccatggtgggcagtggtctgaacccc
tatatggacttcccacctactgatactctgggatatgggggacctgaaggggcagcagct
gagccttatggagcgaggggtccaggctctctgcctcttgggcctggtccacccaccaac
tatggccccaacccctgtccccagcaggcctcatatcctgaccccacccaagaaacatgg
ggtgagttcccttcccactctgggctgtacccaggccccaaggctctaggtggaacctac
agccagtgtcctcgacttgaacattatggacaagtgcaagtcaagccagaacaggggtgc
ccagtggggtctgactccacaggactggcaccctgcctcaatgcccaccccagtgagggg
cccccacatccacagcctctcttttcccattacccccagccctctcctccccaatatctc
cagtcaggcccctatacccagccaccccctgattatcttccttcagaacccaggccttgc
ctggactttgattcccccacccattccacagggcagctcaaggctcagcttgtgtgtaat
tatgttcaatctcaacaggagctactgtgggagggtgggggcagggaagatgcccccgcc
caggaaccttcctaccagagtcccaagtttctggggggttcccaggttagcccaagccgt
gctaaagctccagtgaacacatatggacctggctttggacccaacttgcccaatcacaag
tcaggttcctatcccaccccttcaccatgccatgaaaattttgtagtgggggcaaatagg
gcttcacatagggcagcagcaccacctcgacttctgcccccattgcccacttgctatggg
cctctcaaagtgggaggcacaaaccccagctgtggtcatcctgaggtgggcaggctagga
gggggtcctgccttgtaccctcctcccgaaggacaggtatgtaaccccctggactctctt
gatcttgacaacactcagctggactttgtggctattctggatgagccccaggggctgagt
cctcctccttcccatgatcagcggggcagctctggacataccccacctccctctgggccc
cccaacatggctgtgggcaacatgagtgtcttactgagatccctacctggggaaacagaa
ttcctcaactctagtgcctaa

KEGG   Homo sapiens (human): 2736Help
Entry
2736              CDS       T01001                                 

Gene name
GLI2, CJS, HPE9, PHS2, THP1, THP2
Definition
(RefSeq) GLI family zinc finger 2
  KO
K16798  zinc finger protein GLI2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Module
hsa_M00678  Hedgehog signaling
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H00267  Holoprosencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    2736 (GLI2)
   04390 Hippo signaling pathway
    2736 (GLI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2736 (GLI2)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    2736 (GLI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2736 (GLI2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    2736 (GLI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Motif
Other DBs
NCBI-GeneID: 2736
NCBI-ProteinID: NP_005261
OMIM: 165230
HGNC: 4318
Ensembl: ENSG00000074047
Vega: OTTHUMG00000153741
Pharos: P10070(Tchem)
UniProt: P10070 Q1PSW9 Q59FV5
Position
2q14.2
AA seq 1586 aa AA seqDB search
METSASATASEKQEAKSGILEAAGFPDPGKKASPLVVAAAAAAAVAAQGVPQHLLPPFHA
PLPIDMRHQEGRYHYEPHSVHGVHGPPALSGSPVISDISLIRLSPHPAGPGESPFNAPHP
YVNPHMEHYLRSVHSSPTLSMISAARGLSPADVAQEHLKERGLFGLPAPGTTPSDYYHQM
TLVAGHPAPYGDLLMQSGGAASAPHLHDYLNPVDVSRFSSPRVTPRLSRKRALSISPLSD
ASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQIL
SQQRGLGSAFGHTPPLIQPSPTFLAQQPMALTSINATPTQLSSSSNCLSDTNQNKQSSES
AVSSTVNPVAIHKRSKVKTEPEGLRPASPLALTQGQVSGHGSCGCALPLSQEQLADLKED
LDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTRE
QKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGC
NKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQR
NDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTESSGLCQSSPGA
QSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLR
KHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILENFSGSGGGGPA
GLLPNPRLSELSASEVTMLSQLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASP
LGAGRPHNASSADSYDPISTDASRRSSEASQCSGGSGLLNLTPAQQYSLRAKYAAATGGP
PPTPLPGLERMSLRTRLALLDAPERTLPAGCPRPLGPRRGSDGPTYGHGHAGAAPAFPHE
APGGGARRASDPVRRPDALSLPRVQRFHSTHNVNPGPLPPCADRRGLRLQSHPSTDGGLA
RGAYSPRPPSISENVAMEAVAAGVDGAGPEADLGLPEDDLVLPDDVVQYIKAHASGALDE
GTGQVYPTESTGFSDNPRLPSPGLHGQRRMVAADSNVGPSAPMLGGCQLGFGAPSSLNKN
NMPVQWNEVSSGTVDALASQVKPPPFPQGNLAVVQQKPAFGQYPGYSPQGLQASPGGLDS
TQPHLQPRSGAPSQGIPRVNYMQQLRQPVAGSQCPGMTTTMSPHACYGQVHPQLSPSTIS
GALNQFPQSCSNMPAKPGHLGHPQQTEVAPDPTTMGNRHRELGVPDSALAGVPPPHPVQS
YPQQSHHLAASMSQEGYHQVPSLLPARQPGFMEPQTGPMGVATAGFGLVQPRPPLEPSPT
GRHRGVRAVQQQLAYARATGHAMAAMPSSQETAEAVPKGAMGNMGSVPPQPPPQDAGGAP
DHSMLYYYGQIHMYEQDGGLENLGSCQVMRSQPPQPQACQDSIQPQPLPSPGVNQVSSTV
DSQLLEAPQIDFDAIMDDGDHSSLFSGALSPSLLHSLSQNSSRLTTPRNSLTLPSIPAGI
SNMAVGDMSSMLTSLAEESKFLNMMT
NT seq 4761 nt NT seq  +upstreamnt  +downstreamnt
atggagacgtctgcctcagccactgcctccgagaagcaagaagccaaaagtgggatcctg
gaggccgctggcttccccgacccgggtaaaaaggcctctcctttggtggtggctgcagcg
gcagcagcagcggtagctgcccaaggagtgccgcagcatctcttgccaccattccatgcg
cccctaccgattgacatgcgacaccaggaaggaaggtaccattacgagcctcattctgtc
cacggtgtgcacgggccccctgccctcagcggcagccctgtcatctctgacatctccttg
atccggctttccccgcacccggctggccctggggagtcccccttcaacgccccccacccg
tacgtgaacccccacatggagcactacctccgttctgtgcacagcagccccacgctctcc
atgatctctgcagccaggggcctcagccccgctgatgtggcccaggagcaccttaaggag
aggggactgtttggccttcctgctccaggcaccaccccctcagactattaccaccagatg
accctcgtggcaggccaccccgcgccctacggggacctgctgatgcagagcgggggcgct
gccagcgcaccccatctccacgactacctcaaccccgtggacgtgtcccgtttctccagc
ccgcgggtgacgccccgcctgagccgcaagcgggcgctgtccatctccccactctcagac
gccagcctggacctgcagcggatgatccgcacctcacccaactcgctagtggcctacatc
aacaactcccgaagcagctcggcggccagcggttcctacgggcatctgtcagcgggtgcc
ctcagcccagccttcaccttcccccaccccatcaaccccgtggcctaccagcagattctg
agccagcagaggggtctggggtcagcctttggacacacaccacccctgatccagccctca
cccaccttcctggcccagcagcccatggccctcacctccatcaatgccacgcccacccag
ctcagcagcagcagcaactgtctgagtgacaccaaccagaacaagcagagcagtgagtcg
gccgtcagcagcaccgtcaaccctgtcgccattcacaagcgcagcaaggtcaagaccgag
cctgagggcctgcggccggcctcccctctggcgctgacgcagggccaggtgtctggacac
ggctcatgtgggtgtgcccttcccctctcccaggagcagctggctgacctcaaggaagat
ctggacagggatgactgtaagcaggaggctgaggtggtcatctatgagaccaactgccac
tgggaagactgcaccaaggagtacgacacccaggagcagctggtgcatcacatcaacaac
gagcacatccacggggagaagaaggagtttgtgtgccgctggcaggcctgcacgcgggag
cagaagcccttcaaggcgcagtacatgctggtggtgcacatgcggcgacacacgggcgag
aagccccacaagtgcacgttcgagggctgctcgaaggcctactcccgcctggagaacctg
aagacacacctgcggtcccacaccggggagaagccatatgtgtgtgagcacgagggctgc
aacaaagccttctccaacgcctcggaccgcgccaagcaccagaatcgcacccactccaac
gagaaaccctacatctgcaagatcccaggctgcaccaagagatacacagaccccagctct
ctccggaagcatgtgaaaacggtccacggcccagatgcccacgtcaccaagaagcagcgc
aatgacgtgcacctccgcacaccgctgctcaaagagaatggggacagtgaggccggcacg
gagcctggcggcccagagagcaccgaggccagcagcaccagccaggccgtggaggactgc
ctgcacgtcagagccatcaagaccgagagctccgggctgtgtcagtccagccccggggcc
cagtcgtcctgcagcagcgagccctctcctctgggcagtgcccccaacaatgacagtggc
gtggagatgccggggacggggcccgggagcctgggagacctgacggcactggatgacaca
cccccaggggccgacacctcagccctggctgccccctccgctggtggcctccagctgcgc
aaacacatgaccaccatgcaccggttcgagcagctcaagaaggagaagctcaagtcactc
aaggattcctgctcatgggccgggccgactccacacacgcggaacaccaagctgcctccc
ctcccgggaagtggctccatcctggaaaacttcagtggcagtgggggcggcgggcccgcg
gggctgctgccgaacccgcggctgtcggagctgtccgcgagcgaggtgaccatgctgagc
cagctgcaggagcgccgcgacagctccaccagcacggtcagctcggcctacaccgtgagc
cgccgctcctccggcatctccccctacttctccagccgccgctccagcgaggcctcgccc
ctgggcgccggccgcccgcacaacgcgagctccgctgactcctacgaccccatctccacg
gacgcgtcgcggcgctcgagcgaggccagccagtgcagcggcggctccgggctgctcaac
ctcacgccggcgcagcagtacagcctgcgggccaagtacgcggcagccactggcggcccc
ccgcccactccgctgccgggcctggagcgcatgagcctgcggaccaggctggcgctgctg
gacgcgcccgagcgcacgctgcccgccggctgcccacgcccactggggccgcggcgtggc
agcgacgggccgacctatggccacggccacgcgggggctgcgcccgccttcccccacgag
gctccaggcggcggagccaggcgggccagcgaccctgtgcggcggcccgatgccctgtcc
ctgccgcgggtgcagcgcttccacagcacccacaacgtgaaccccggcccgctgccgccc
tgtgccgacaggcgaggcctccgcctgcagagccacccgagcaccgacggcggcctggcc
cgcggcgcctactcgccccggccgcctagcatcagcgagaacgtggcgatggaggccgtg
gcggcaggagtggacggcgcggggcccgaggccgacctggggctgccggaggacgacctg
gtgcttccagacgacgtggtgcagtacatcaaggcgcacgccagtggcgctctggacgag
ggcaccgggcaggtgtatcccacggaaagcactggcttctctgacaaccccagactaccc
agcccggggctgcacggccagcgcaggatggtggctgcggactccaacgtgggcccctcc
gcccctatgctgggaggatgccagttaggctttggggcgccctccagcctgaacaaaaat
aacatgcctgtgcagtggaatgaggtgagctccggcaccgtagacgccctggccagccag
gtgaagcctccaccctttcctcagggcaacctggcggtggtgcagcagaagcctgccttt
ggccagtacccgggctacagtccgcaaggcctacaggctagccctgggggcctggacagc
acgcagccacacctgcagccccgcagcggagccccctcccagggcatccccagggtaaac
tacatgcagcagctgcgacagccagtggcaggcagccagtgtcctggcatgactaccact
atgagcccccatgcctgctatggccaagtccacccccagctgagccccagcaccatcagt
ggggccctcaaccagttcccccaatcctgcagcaacatgccagccaagccagggcatctg
gggcaccctcagcagacagaagtggcacctgaccccaccacgatgggcaatcgccacagg
gaacttggggtccccgattcagccctggctggagtgccaccacctcacccagtccagagc
tacccacagcagagccatcacctggcagcctccatgagccaggagggctaccaccaggtc
cccagccttctgcctgcccgccagcctggcttcatggagccccaaacaggcccgatgggg
gtggctacagcaggctttggcctagtgcagccccggcctcccctcgagcccagccccact
ggccgccaccgtggggtacgtgctgtgcagcagcagctggcctacgccagggccacaggc
catgccatggctgccatgccgtccagtcaggaaacagcagaggctgtgcccaagggagcg
atgggcaacatggggtcggtgcctccccagccgcctccgcaggacgcaggtggggccccg
gaccacagcatgctctactactacggccagatccacatgtacgaacaggatggaggcctg
gagaacctcgggagctgccaggtcatgcggtcccagccaccacagccacaggcctgtcag
gacagcatccagccccagcccttgccctcaccaggggtcaaccaggtgtccagcactgtg
gactcccagctcctggaggccccccagattgacttcgatgccatcatggatgatggcgat
cactcgagtttgttctcgggtgctctgagccccagcctcctccacagcctctcccagaac
tcctcccgcctcaccaccccccgaaactccttgaccctgccctccatccccgcaggcatc
agcaacatggctgtcggggacatgagctccatgctcaccagcctcgccgaggagagcaag
ttcctgaacatgatgacctag

KEGG   Homo sapiens (human): 2737Help
Entry
2737              CDS       T01001                                 

Gene name
GLI3, ACLS, GCPS, GLI3-190, GLI3FL, PAP-A, PAPA, PAPA1, PAPB, PHS, PPDIV
Definition
(RefSeq) GLI family zinc finger 3
  KO
K06230  zinc finger protein GLI3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04340  Hedgehog signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Module
hsa_M00678  Hedgehog signaling
Network
nt06217  HH signaling
nt06269  Basal cell carcinoma
  Element
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H00502  Pallister-Hall syndrome
H01226  Polysyndactyly
H01852  Postaxial polydactyly
H02161  Greig cephalopolysyndactyly syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    2737 (GLI3)
   04024 cAMP signaling pathway
    2737 (GLI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2737 (GLI3)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    2737 (GLI3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2737 (GLI3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    2737 (GLI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC IL17
Motif
Other DBs
NCBI-GeneID: 2737
NCBI-ProteinID: NP_000159
OMIM: 165240
HGNC: 4319
Ensembl: ENSG00000106571
Vega: OTTHUMG00000023630
Pharos: P10071(Tbio)
UniProt: P10071
Position
7p14.1
AA seq 1580 aa AA seqDB search
MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITM
QPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFAMDPRNGYMEP
HYHPPHLFPAFHPPVPIDARHHEGRYHYDPSPIPPLHMTSALSSSPTYPDLPFIRISPHR
NPTAASESPFSPPHPYINPYMDYIRSLHSSPSLSMISATRGLSPTDAPHAGVSPAEYYHQ
MALLTGQRSPYADIIPSAATAGTGAIHMEYLHAMDSTRFSSPRLSARPSRKRTLSISPLS
DHSFDLQTMIRTSPNSLVTILNNSRSSSSASGSYGHLSASAISPALSFTYSSAPVSLHMH
QQILSRQQSLGSAFGHSPPLIHPAPTFPTQRPIPGIPTVLNPVQVSSGPSESSQNKPTSE
SAVSSTGDPMHNKRSKIKPDEDLPSPGARGQQEQPEGTTLVKEEGDKDESKQEPEVIYET
NCHWEGCAREFDTQEQLVHHINNDHIHGEKKEFVCRWLDCSREQKPFKAQYMLVVHMRRH
TGEKPHKCTFEGCTKAYSRLENLKTHLRSHTGEKPYVCEHEGCNKAFSNASDRAKHQNRT
HSNEKPYVCKIPGCTKRYTDPSSLRKHVKTVHGPEAHVTKKQRGDIHPRPPPPRDSGSHS
QSRSPGRPTQGALGEQQDLSNTTSKREECLQVKTVKAEKPMTSQPSPGGQSSCSSQQSPI
SNYSNSGLELPLTDGGSIGDLSAIDETPIMDSTISTATTALALQARRNPAGTKWMEHVKL
ERLKQVNGMFPRLNPILPPKAPAVSPLIGNGTQSNNTCSLGGPMTLLPGRSDLSGVDVTM
LNMLNRRDSSASTISSAYLSSRRSSGISPCFSSRRSSEASQAEGRPQNVSVADSYDPIST
DASRRSSEASQSDGLPSLLSLTPAQQYRLKAKYAAATGGPPPTPLPNMERMSLKTRLALL
GDALEPGVALPPVHAPRRCSDGGAHGYGRRHLQPHDAPGHGVRRASDPVRTGSEGLALPR
VPRFSSLSSCNPPAMATSAEKRSLVLQNYTRPEGGQSRNFHSSPCPPSITENVTLESLTM
DADANLNDEDFLPDDVVQYLNSQNQAGYEQHFPSALPDDSKVPHGPGDFDAPGLPDSHAG
QQFHALEQPCPEGSKTDLPIQWNEVSSGSADLSSSKLKCGPRPAVPQTRAFGFCNGMVVH
PQNPLRSGPAGGYQTLGENSNPYGGPEHLMLHNSPGSGTSGNAFHEQPCKAPQYGNCLNR
QPVAPGALDGACGAGIQASKLKSTPMQGSGGQLNFGLPVAPNESAGSMVNGMQNQDPVGQ
GYLAHQLLGDSMQHPGAGRPGQQMLGQISATSHINIYQGPESCLPGAHGMGSQPSSLAVV
RGYQPCASFGGSRRQAMPRDSLALQSGQLSDTSQTCRVNGIKMEMKGQPHPLCSNLQNYS
GQFYDQTVGFSQQDTKAGSFSISDASCLLQGTSAKNSELLSPGANQVTSTVDSLDSHDLE
GVQIDFDAIIDDGDHSSLMSGALSPSIIQNLSHSSSRLTTPRASLPFPALSMSTTNMAIG
DMSSLLTSLAEESKFLAVMQ
NT seq 4743 nt NT seq  +upstreamnt  +downstreamnt
atggaggcccagtcccacagctccacgaccactgaaaagaaaaaagttgagaattccata
gtgaagtgctccactcgaacagatgtgagcgagaaagccgttgcctccagcaccacttct
aatgaggatgaaagtcctggacagacttatcacagagagagaagaaacgcaatcactatg
cagccacagaatgtccaggggctcagcaaagtcagtgaggaaccttcaacatcgagtgac
gagagggcctcattgatcaagaaagagatccatgggtccctgccacacgtggcggagccc
tctgtgccgtaccgcgggacggtgtttgccatggaccccaggaatggttacatggagccc
cactaccaccctcctcatcttttccctgccttccatcctcctgtaccaattgatgccaga
catcatgagggccgttaccattacgatccatctccgattcctccattgcatatgacttcc
gccttatctagtagccctacgtatccggacctgcccttcattaggatctccccacaccgg
aaccccactgctgcttccgagtctcccttcagccctccacatccctacattaatccctac
atggactatatccgctccttgcacagcagcccatcgctctccatgatctcagcaacccgt
gggctgagccctacagatgcgccccatgcaggagtcagcccagcagaatactatcatcag
atggccctgctaactggccagcgcagcccctatgcagacattattccctcagctgccacc
gccggcacgggggccatccacatggaatatcttcatgctatggatagcaccagattctcc
agccccaggctgtcagccaggccgagccgaaaacgtacactgtccatatcaccactctcc
gatcatagctttgaccttcagaccatgataaggacgtctcccaactccttggtcacgatt
ctcaataattcccgtagcagctcttcagcaagtggctcctatggtcacttatctgcaagt
gcaatcagccctgccttgagcttcacctactcttccgcgcccgtctctctccacatgcat
cagcagatcctaagccgacaacagagcttaggttcagcctttggacacagccctccactc
atccaccctgccccaacttttccaacacagaggcctattccagggatccctacggttctg
aaccccgtccaggtcagctccggcccttctgagtcctcacagaacaagcccacgagtgag
tctgcagtgagcagcactggtgacccgatgcacaacaagaggtccaagatcaaacccgat
gaagacctccccagcccaggggctcgggggcagcaggaacagcccgaaggaacaaccctt
gtcaaggaggaaggggacaaagatgaaagcaaacaggagcctgaagtcatctatgagaca
aactgccactgggaaggctgcgcgagggagttcgacacccaagagcagcttgtgcaccat
ataaataacgaccatattcatggagagaagaaggagttcgtgtgcaggtggctggactgc
tcaagagagcagaaacccttcaaagcccagtatatgttggtagtgcatatgagaagacac
acgggcgagaagcctcacaaatgcacttttgaaggttgcacaaaggcctactcgagacta
gaaaacttgaaaacacacttgagatctcacactggagagaaaccatacgtctgtgagcac
gaaggttgcaacaaggctttctcaaatgcctctgatcgcgccaaacaccaaaacagaacg
cattccaatgagaaaccatatgtgtgcaaaatcccaggctgcactaagcgttacacagac
ccaagctccctccggaaacatgtgaagacagtgcatggcccagaggctcatgtcaccaag
aagcagcgaggggacatccatcctcggccgccacccccgagagattccggcagccattca
cagtccaggtcgcctggccgaccgactcagggagcccttggtgagcagcaggacctcagc
aacactacctcaaagcgggaagaatgcctccaggtgaaaaccgtcaaggcagagaagcca
atgacatctcagccaagccctggtggtcagtcttcatgcagcagccaacagtcccccatc
agcaactattccaacagtgggctcgagcttcctctgaccgatggaggtagtataggagac
ctcagtgccatcgatgaaaccccaatcatggactcaaccatttccactgcaaccacagcc
cttgctttgcaagccaggagaaacccggcagggaccaaatggatggagcacgtaaaacta
gaaaggctaaaacaagtgaatggaatgtttccgcgactgaaccccattctaccccctaaa
gcccctgcggtctctcctctcataggaaatggcacacagtccaacaacacctgcagcttg
ggtgggcccatgacgcttctcccgggcagaagcgacctctctggggtggacgtcactatg
ctgaacatgctcaacagaagggacagcagcgccagcaccatcagctcggcctacctgagc
agccgccgctcctcagggatctcgccctgcttctccagccgccgctccagcgaggcgtca
caggccgagggccggccgcagaacgtgagcgtggccgactcctacgaccccatctccacc
gacgcctcgcgccgctccagcgaagccagccagagcgacggcctgcccagcctgctcagc
ctcacgcccgcccagcagtaccgcctcaaggccaagtacgcggctgccacaggagggccg
ccgccgacgcccctgcccaacatggagaggatgagcctgaagacgcgcctggcgctgctc
ggggatgccctcgagcctggcgtggccctgcctccagttcatgccccgaggaggtgcagc
gacgggggagcccacggctacgggcggcgccacctgcagccgcacgatgcgccgggccac
ggcgtgaggagggccagcgacccggtgcggacaggctccgagggcctggccctgcctcgt
gtgccgcgcttcagcagcctcagcagctgcaaccccccggcgatggccacgtccgcggag
aagcgcagtctcgtgcttcagaattacacgcggcccgagggcggccagtcccgaaacttc
cactcgtccccctgtcctcccagcatcaccgagaacgtcaccctggagtccctgaccatg
gacgctgatgccaacctgaacgatgaggatttcctgccggacgacgtggtgcagtattta
aattcccagaaccaagcagggtacgagcagcacttccccagcgccctcccggacgacagc
aaagtgccccacgggcccggtgactttgacgcgcccgggctgccagacagccacgctggc
cagcagttccatgccctcgagcagccctgccccgagggcagcaaaaccgacctgcccatt
cagtggaacgaagtcagctccggaagcgccgacctgtcctcctccaagctcaagtgtggg
ccgcggcccgctgtgccgcagactcgcgcctttgggttctgcaacggcatggtcgtccac
ccgcagaaccccttgaggagcgggcctgctgggggctatcagaccctcggggagaacagc
aacccctacggtggcccagagcacttgatgctccacaacagccccggaagtggcaccagt
ggaaacgccttccatgaacagccctgtaaggccccgcagtatgggaactgtctcaacagg
cagccagtggcccctggtgcactcgacggtgcctgtggtgccgggattcaagcctcaaag
ctgaagagcacccccatgcaagggagcgggggccagctgaatttcggcctgccggtagcg
ccaaatgagtcagctggcagcatggtgaatggcatgcagaaccaggacccagtgggacag
gggtacctggctcaccagctcctcggcgacagcatgcagcacccgggggcaggccgcccc
ggtcagcagatgcttgggcagattagtgctacctcacacatcaacatctaccaagggcca
gagagctgcctgccaggggctcacggcatgggcagccagccgtcaagcttggcagttgtc
aggggctaccagccatgtgccagctttgggggcagcaggcgccaggctatgccgagggac
agccttgctctgcagtcaggacagctcagtgacacaagtcagacctgcagggtgaatggt
atcaagatggagatgaaagggcagccccatccgctgtgctctaatctgcagaattactct
ggtcagttctatgaccaaaccgtgggcttcagtcagcaagacacgaaagctggttcattc
tctatttcagacgccagctgcctgctacaggggaccagcgccaaaaactctgagttactt
tccccaggtgctaatcaggtgacaagcacagtggacagcctcgacagccatgacctggaa
ggggtacagattgacttcgatgccatcatagacgatggggaccactccagcctgatgtcg
ggggccctgagcccaagtatcattcagaacctttcccatagctcctcccgcctcaccacg
cctcgggcgtccctcccattcccagcgctgtccatgagcaccaccaacatggctatcggg
gacatgagttctttgctgacctccctagcggaagaaagcaaattccttgcagttatgcaa
tag

DBGET integrated database retrieval system