KEGG   Homo sapiens (human): 27351
Entry
27351             CDS       T01001                                 

Gene name
DESI1, D15Wsu75e, DESI2, DJ347H13.4, DeSI-1, FAM152B, POST, PPPDE2
Definition
(RefSeq) desumoylating isopeptidase 1
  KO
K22762  desumoylating isopeptidase 1 [EC:3.4.-.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    27351 (DESI1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    27351 (DESI1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.-  Acting on peptide bonds (peptidases)
    3.4.-.-  
     27351 (DESI1)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C97
   27351 (DESI1)
Ubiquitin system [BR:hsa04121]
 Deubiquitinating enzyme (DUB)
  UBL-specific proteases (ULPs)
   27351 (DESI1)
SSDB
Motif
Pfam: Peptidase_C97
Other DBs
NCBI-GeneID: 27351
NCBI-ProteinID: NP_056519
OMIM: 614637
HGNC: 24577
Ensembl: ENSG00000100418
Vega: OTTHUMG00000044632
Pharos: Q6ICB0(Tdark)
UniProt: Q6ICB0
Structure
PDB: 
3EBQ

Position
22q13.2
AA seq 168 aa
MEPPNLYPVKLYVYDLSKGLARRLSPIMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPP
GGTLLGPPDSVVDVGSTEVTEEIFLEYLSSLGESLFRGEAYNLFEHNCNTFSNEVAQFLT
GRKIPSYITDLPSEVLSTPFGQALRPLLDSIQIQPPGGSSVGRPNGQS
NT seq 507 nt   +upstreamnt  +downstreamnt
atggagccgccgaatctctatccggtgaagctctacgtgtacgacctgtccaaaggcctg
gcccggcggctcagccccatcatgctggggaaacaactggaaggcatctggcacacatcc
atagttgtgcacaaggatgagttcttcttcggcagtggtggtatctccagctgccccccg
ggagggacattgcttgggcctccagactctgtggttgatgtggggagtacagaagtcaca
gaagaaatctttctggagtacctctcctccctgggggagtccctgttccgaggtgaggcc
tacaacctctttgaacacaattgtaacaccttcagcaacgaagtggcacagttcctgact
gggcggaagattccttcttacatcacagacctgccctctgaagttctctccacgcccttt
ggacaggcacttcggcccctcctggactccattcagatccagcctccaggagggagctcc
gtgggcagacccaacggccagagctaa

DBGET integrated database retrieval system