KEGG   Homo sapiens (human): 27352Help
Entry
27352             CDS       T01001                                 

Gene name
SGSM3, CIP85, MAP, RABGAP5, RUSC3, RUTBC3, RabGAP-5, rabGAPLP
Definition
(RefSeq) small G protein signaling modulator 3
  KO
K20176  small G protein signaling modulator 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    27352 (SGSM3)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    27352 (SGSM3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RabGAP-TBC RUN SH3_1 SH3_2 SH3_9
Motif
Other DBs
NCBI-GeneID: 27352
NCBI-ProteinID: NP_056520
OMIM: 610440
HGNC: 25228
Ensembl: ENSG00000100359
Vega: OTTHUMG00000151141
Pharos: Q96HU1(Tbio)
UniProt: Q96HU1 B9A6J5
Position
22q13.1
AA seq 749 aa AA seqDB search
MSGSHTPACGPFSALTPSIWPQEILAKYTQKEESAEQPEFYYDEFGFRVYKEEGDEPGSS
LLANSPLMEDAPQRLRWQAHLEFTHNHDVGDLTWDKIAVSLPRSEKLRSLVLAGIPHGMR
PQLWMRLSGALQKKRNSELSYREIVKNSSNDETIAAKQIEKDLLRTMPSNACFASMGSIG
VPRLRRVLRALAWLYPEIGYCQGTGMVAACLLLFLEEEDAFWMMSAIIEDLLPASYFSTT
LLGVQTDQRVLRHLIVQYLPRLDKLLQEHDIELSLITLHWFLTAFASVVDIKLLLRIWDL
FFYEGSRVLFQLTLGMLHLKEEELIQSENSASIFNTLSDIPSQMEDAELLLGVAMRLAGS
LTDVAVETQRRKHLAYLIADQGQLLGAGTLTNLSQVVRRRTQRRKSTITALLFGEDDLEA
LKAKNIKQTELVADLREAILRVARHFQCTDPKNCSVELTPDYSMESHQRDHENYVACSRS
HRRRAKALLDFERHDDDELGFRKNDIITIVSQKDEHCWVGELNGLRGWFPAKFVEVLDER
SKEYSIAGDDSVTEGVTDLVRGTLCPALKALFEHGLKKPSLLGGACHPWLFIEEAAGREV
ERDFASVYSRLVLCKTFRLDEDGKVLTPEELLYRAVQSVNVTHDAVHAQMDVKLRSLICV
GLNEQVLHLWLEVLCSSLPTVEKWYQPWSFLRSPGWVQIKCELRVLCCFAFSLSQDWELP
AKREAQQPLKEGVRDMLVKHHLFSWDVDG
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggaagccatacacctgcctgtggccctttctcagccctgactccgagcatatgg
ccccaggagatcttggccaagtacacgcagaaggaagagtcagcagagcaaccagagttc
tactacgatgagtttggtttccgtgtgtacaaggaagaaggtgatgagcctggctccagt
ctgctggcgaactcccctctgatggaggatgctccacagaggctgcggtggcaggcccac
ctggagttcacccataaccacgatgtgggggatctcacctgggacaagattgccgtctcc
ctaccccgctctgagaagctccgctccctggtgctggccggcatcccacatggcatgagg
ccacagctgtggatgcggctctctggggccctgcagaagaagaggaactctgagctgtcc
taccgcgagattgtgaagaacagctccaacgatgagaccatcgctgccaagcagatcgag
aaggacctgctccgcaccatgcccagcaacgcctgcttcgccagcatgggtagcatcggg
gtgccccgcctgcgcagggtgctccgggccctggcctggctctacccagagatcggctac
tgccagggcaccggcatggtggccgcctgcctcctgctgttcctggaggaggaggacgcc
ttctggatgatgtctgccatcatcgaggacctgctccccgcctcctacttcagcaccacc
ctgctgggtgtccagactgaccagcgggtcctgcgccacctcattgtccagtacctgcct
cgcctggacaagctgctccaggagcatgacattgagctgtccctgatcacactgcactgg
ttcctcacggccttcgccagcgtggtggacatcaagctgctcctgcgcatctgggacctg
tttttctacgagggctcccgggtgctgttccagctcacgctgggcatgctgcacctcaag
gaggaagagctgatccagtcagagaactcggcctccatcttcaacacgctatcggatatc
ccgtcgcagatggaggacgcggagctgcttctgggggtggccatgcggctggccggctcc
ctcaccgatgtggccgtggagactcagcgccgcaagcacctggcctatctcattgcagac
cagggccagctcctgggggccggcaccctcaccaacctctctcaggttgttcgccgcagg
acccagcggaggaagtccaccatcactgctctgctcttcggggaggatgacctggaggca
ctcaaggccaagaacatcaagcagacggaactggtggctgacctccgggaagccatcctg
cgcgtggcacgccacttccagtgcacagaccccaaaaactgcagcgtggagctgactcca
gactatagcatggagagccaccagcgggaccacgagaactacgtggcgtgctcacgcagc
caccggcgccgagccaaggccctgctggactttgagcggcacgacgacgacgagctgggc
ttccgcaagaacgacatcatcacaatcgtgtctcagaaggacgagcactgctgggtgggg
gagctcaacggcctgcgaggctggtttccagccaagttcgtggaagtcctggatgagcgc
agcaaagagtactccatcgcgggggatgactcggtgacggagggggtcacagacctcgtg
cgagggaccctctgcccggcccttaaggccctgttcgaacatggactgaagaagccatcc
ctgcttgggggcgcctgccacccctggctgtttatcgaggaggctgcaggccgggaggtc
gagagagactttgcctccgtgtattcccgtctggtgctctgtaagaccttcaggttggat
gaagatggcaaagtcctgaccccggaggagctgctctaccgggctgtgcagtctgtgaac
gtgacccacgatgcagtgcatgcacaaatggatgtgaagctccgctcactgatctgcgtg
gggctcaatgagcaggtgctgcacctgtggctggaggtgctctgctccagcctgcccacc
gtggagaagtggtaccagccctggtccttcctgcgcagcccgggctgggtccagatcaag
tgtgagctccgagtcctctgctgctttgccttcagcctctcccaggactgggagctccct
gcgaagagagaggcgcagcagcccctgaaggagggcgtccgggacatgctggtgaagcac
cacctcttcagctgggatgtggacgggtga

DBGET integrated database retrieval system