KEGG   Homo sapiens (human): 2736Help
Entry
2736              CDS       T01001                                 

Gene name
GLI2, CJS, HPE9, PHS2, THP1, THP2
Definition
(RefSeq) GLI family zinc finger 2
  KO
K16798  zinc finger protein GLI2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04390  Hippo signaling pathway
hsa05200  Pathways in cancer
hsa05217  Basal cell carcinoma
Module
hsa_M00678  Hedgehog signaling
Network
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00062  Hedgehog signaling pathway
Disease
H00267  Holoprosencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    2736 (GLI2)
   04390 Hippo signaling pathway
    2736 (GLI2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    2736 (GLI2)
  09162 Cancers: Specific types
   05217 Basal cell carcinoma
    2736 (GLI2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2736 (GLI2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    2736 (GLI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 FOXP-CC
Motif
Other DBs
NCBI-GeneID: 2736
NCBI-ProteinID: NP_005261
OMIM: 165230
HGNC: 4318
Ensembl: ENSG00000074047
Vega: OTTHUMG00000153741
Pharos: P10070(Tchem)
UniProt: P10070 Q1PSW9 Q59FV5
Position
2q14.2
AA seq 1586 aa AA seqDB search
METSASATASEKQEAKSGILEAAGFPDPGKKASPLVVAAAAAAAVAAQGVPQHLLPPFHA
PLPIDMRHQEGRYHYEPHSVHGVHGPPALSGSPVISDISLIRLSPHPAGPGESPFNAPHP
YVNPHMEHYLRSVHSSPTLSMISAARGLSPADVAQEHLKERGLFGLPAPGTTPSDYYHQM
TLVAGHPAPYGDLLMQSGGAASAPHLHDYLNPVDVSRFSSPRVTPRLSRKRALSISPLSD
ASLDLQRMIRTSPNSLVAYINNSRSSSAASGSYGHLSAGALSPAFTFPHPINPVAYQQIL
SQQRGLGSAFGHTPPLIQPSPTFLAQQPMALTSINATPTQLSSSSNCLSDTNQNKQSSES
AVSSTVNPVAIHKRSKVKTEPEGLRPASPLALTQGQVSGHGSCGCALPLSQEQLADLKED
LDRDDCKQEAEVVIYETNCHWEDCTKEYDTQEQLVHHINNEHIHGEKKEFVCRWQACTRE
QKPFKAQYMLVVHMRRHTGEKPHKCTFEGCSKAYSRLENLKTHLRSHTGEKPYVCEHEGC
NKAFSNASDRAKHQNRTHSNEKPYICKIPGCTKRYTDPSSLRKHVKTVHGPDAHVTKKQR
NDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTESSGLCQSSPGA
QSSCSSEPSPLGSAPNNDSGVEMPGTGPGSLGDLTALDDTPPGADTSALAAPSAGGLQLR
KHMTTMHRFEQLKKEKLKSLKDSCSWAGPTPHTRNTKLPPLPGSGSILENFSGSGGGGPA
GLLPNPRLSELSASEVTMLSQLQERRDSSTSTVSSAYTVSRRSSGISPYFSSRRSSEASP
LGAGRPHNASSADSYDPISTDASRRSSEASQCSGGSGLLNLTPAQQYSLRAKYAAATGGP
PPTPLPGLERMSLRTRLALLDAPERTLPAGCPRPLGPRRGSDGPTYGHGHAGAAPAFPHE
APGGGARRASDPVRRPDALSLPRVQRFHSTHNVNPGPLPPCADRRGLRLQSHPSTDGGLA
RGAYSPRPPSISENVAMEAVAAGVDGAGPEADLGLPEDDLVLPDDVVQYIKAHASGALDE
GTGQVYPTESTGFSDNPRLPSPGLHGQRRMVAADSNVGPSAPMLGGCQLGFGAPSSLNKN
NMPVQWNEVSSGTVDALASQVKPPPFPQGNLAVVQQKPAFGQYPGYSPQGLQASPGGLDS
TQPHLQPRSGAPSQGIPRVNYMQQLRQPVAGSQCPGMTTTMSPHACYGQVHPQLSPSTIS
GALNQFPQSCSNMPAKPGHLGHPQQTEVAPDPTTMGNRHRELGVPDSALAGVPPPHPVQS
YPQQSHHLAASMSQEGYHQVPSLLPARQPGFMEPQTGPMGVATAGFGLVQPRPPLEPSPT
GRHRGVRAVQQQLAYARATGHAMAAMPSSQETAEAVPKGAMGNMGSVPPQPPPQDAGGAP
DHSMLYYYGQIHMYEQDGGLENLGSCQVMRSQPPQPQACQDSIQPQPLPSPGVNQVSSTV
DSQLLEAPQIDFDAIMDDGDHSSLFSGALSPSLLHSLSQNSSRLTTPRNSLTLPSIPAGI
SNMAVGDMSSMLTSLAEESKFLNMMT
NT seq 4761 nt NT seq  +upstreamnt  +downstreamnt
atggagacgtctgcctcagccactgcctccgagaagcaagaagccaaaagtgggatcctg
gaggccgctggcttccccgacccgggtaaaaaggcctctcctttggtggtggctgcagcg
gcagcagcagcggtagctgcccaaggagtgccgcagcatctcttgccaccattccatgcg
cccctaccgattgacatgcgacaccaggaaggaaggtaccattacgagcctcattctgtc
cacggtgtgcacgggccccctgccctcagcggcagccctgtcatctctgacatctccttg
atccggctttccccgcacccggctggccctggggagtcccccttcaacgccccccacccg
tacgtgaacccccacatggagcactacctccgttctgtgcacagcagccccacgctctcc
atgatctctgcagccaggggcctcagccccgctgatgtggcccaggagcaccttaaggag
aggggactgtttggccttcctgctccaggcaccaccccctcagactattaccaccagatg
accctcgtggcaggccaccccgcgccctacggggacctgctgatgcagagcgggggcgct
gccagcgcaccccatctccacgactacctcaaccccgtggacgtgtcccgtttctccagc
ccgcgggtgacgccccgcctgagccgcaagcgggcgctgtccatctccccactctcagac
gccagcctggacctgcagcggatgatccgcacctcacccaactcgctagtggcctacatc
aacaactcccgaagcagctcggcggccagcggttcctacgggcatctgtcagcgggtgcc
ctcagcccagccttcaccttcccccaccccatcaaccccgtggcctaccagcagattctg
agccagcagaggggtctggggtcagcctttggacacacaccacccctgatccagccctca
cccaccttcctggcccagcagcccatggccctcacctccatcaatgccacgcccacccag
ctcagcagcagcagcaactgtctgagtgacaccaaccagaacaagcagagcagtgagtcg
gccgtcagcagcaccgtcaaccctgtcgccattcacaagcgcagcaaggtcaagaccgag
cctgagggcctgcggccggcctcccctctggcgctgacgcagggccaggtgtctggacac
ggctcatgtgggtgtgcccttcccctctcccaggagcagctggctgacctcaaggaagat
ctggacagggatgactgtaagcaggaggctgaggtggtcatctatgagaccaactgccac
tgggaagactgcaccaaggagtacgacacccaggagcagctggtgcatcacatcaacaac
gagcacatccacggggagaagaaggagtttgtgtgccgctggcaggcctgcacgcgggag
cagaagcccttcaaggcgcagtacatgctggtggtgcacatgcggcgacacacgggcgag
aagccccacaagtgcacgttcgagggctgctcgaaggcctactcccgcctggagaacctg
aagacacacctgcggtcccacaccggggagaagccatatgtgtgtgagcacgagggctgc
aacaaagccttctccaacgcctcggaccgcgccaagcaccagaatcgcacccactccaac
gagaaaccctacatctgcaagatcccaggctgcaccaagagatacacagaccccagctct
ctccggaagcatgtgaaaacggtccacggcccagatgcccacgtcaccaagaagcagcgc
aatgacgtgcacctccgcacaccgctgctcaaagagaatggggacagtgaggccggcacg
gagcctggcggcccagagagcaccgaggccagcagcaccagccaggccgtggaggactgc
ctgcacgtcagagccatcaagaccgagagctccgggctgtgtcagtccagccccggggcc
cagtcgtcctgcagcagcgagccctctcctctgggcagtgcccccaacaatgacagtggc
gtggagatgccggggacggggcccgggagcctgggagacctgacggcactggatgacaca
cccccaggggccgacacctcagccctggctgccccctccgctggtggcctccagctgcgc
aaacacatgaccaccatgcaccggttcgagcagctcaagaaggagaagctcaagtcactc
aaggattcctgctcatgggccgggccgactccacacacgcggaacaccaagctgcctccc
ctcccgggaagtggctccatcctggaaaacttcagtggcagtgggggcggcgggcccgcg
gggctgctgccgaacccgcggctgtcggagctgtccgcgagcgaggtgaccatgctgagc
cagctgcaggagcgccgcgacagctccaccagcacggtcagctcggcctacaccgtgagc
cgccgctcctccggcatctccccctacttctccagccgccgctccagcgaggcctcgccc
ctgggcgccggccgcccgcacaacgcgagctccgctgactcctacgaccccatctccacg
gacgcgtcgcggcgctcgagcgaggccagccagtgcagcggcggctccgggctgctcaac
ctcacgccggcgcagcagtacagcctgcgggccaagtacgcggcagccactggcggcccc
ccgcccactccgctgccgggcctggagcgcatgagcctgcggaccaggctggcgctgctg
gacgcgcccgagcgcacgctgcccgccggctgcccacgcccactggggccgcggcgtggc
agcgacgggccgacctatggccacggccacgcgggggctgcgcccgccttcccccacgag
gctccaggcggcggagccaggcgggccagcgaccctgtgcggcggcccgatgccctgtcc
ctgccgcgggtgcagcgcttccacagcacccacaacgtgaaccccggcccgctgccgccc
tgtgccgacaggcgaggcctccgcctgcagagccacccgagcaccgacggcggcctggcc
cgcggcgcctactcgccccggccgcctagcatcagcgagaacgtggcgatggaggccgtg
gcggcaggagtggacggcgcggggcccgaggccgacctggggctgccggaggacgacctg
gtgcttccagacgacgtggtgcagtacatcaaggcgcacgccagtggcgctctggacgag
ggcaccgggcaggtgtatcccacggaaagcactggcttctctgacaaccccagactaccc
agcccggggctgcacggccagcgcaggatggtggctgcggactccaacgtgggcccctcc
gcccctatgctgggaggatgccagttaggctttggggcgccctccagcctgaacaaaaat
aacatgcctgtgcagtggaatgaggtgagctccggcaccgtagacgccctggccagccag
gtgaagcctccaccctttcctcagggcaacctggcggtggtgcagcagaagcctgccttt
ggccagtacccgggctacagtccgcaaggcctacaggctagccctgggggcctggacagc
acgcagccacacctgcagccccgcagcggagccccctcccagggcatccccagggtaaac
tacatgcagcagctgcgacagccagtggcaggcagccagtgtcctggcatgactaccact
atgagcccccatgcctgctatggccaagtccacccccagctgagccccagcaccatcagt
ggggccctcaaccagttcccccaatcctgcagcaacatgccagccaagccagggcatctg
gggcaccctcagcagacagaagtggcacctgaccccaccacgatgggcaatcgccacagg
gaacttggggtccccgattcagccctggctggagtgccaccacctcacccagtccagagc
tacccacagcagagccatcacctggcagcctccatgagccaggagggctaccaccaggtc
cccagccttctgcctgcccgccagcctggcttcatggagccccaaacaggcccgatgggg
gtggctacagcaggctttggcctagtgcagccccggcctcccctcgagcccagccccact
ggccgccaccgtggggtacgtgctgtgcagcagcagctggcctacgccagggccacaggc
catgccatggctgccatgccgtccagtcaggaaacagcagaggctgtgcccaagggagcg
atgggcaacatggggtcggtgcctccccagccgcctccgcaggacgcaggtggggccccg
gaccacagcatgctctactactacggccagatccacatgtacgaacaggatggaggcctg
gagaacctcgggagctgccaggtcatgcggtcccagccaccacagccacaggcctgtcag
gacagcatccagccccagcccttgccctcaccaggggtcaaccaggtgtccagcactgtg
gactcccagctcctggaggccccccagattgacttcgatgccatcatggatgatggcgat
cactcgagtttgttctcgggtgctctgagccccagcctcctccacagcctctcccagaac
tcctcccgcctcaccaccccccgaaactccttgaccctgccctccatccccgcaggcatc
agcaacatggctgtcggggacatgagctccatgctcaccagcctcgccgaggagagcaag
ttcctgaacatgatgacctag

DBGET integrated database retrieval system