KEGG   Homo sapiens (human): 2740Help
Entry
2740              CDS       T01001                                 

Gene name
GLP1R, GLP-1, GLP-1-R, GLP-1R
Definition
(RefSeq) glucagon like peptide 1 receptor
  KO
K04581  glucagon-like peptide 1 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04911  Insulin secretion
Drug target
Albiglutide: D08843
Avexitide: D11418
Avexitide acetate: D11419
Dulaglutide: D09889
Exenatide: D04121
Liraglutide: D06404
Lixisenatide: D09729
Pegapamodutide: D10970
Semaglutide: D10025
Taspoglutide: D09723
Tirzepatide: D11360
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2740 (GLP1R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2740 (GLP1R)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    2740 (GLP1R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2740 (GLP1R)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Pancreatic peptide
   Glucagon
    2740 (GLP1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 2740
NCBI-ProteinID: NP_002053
OMIM: 138032
HGNC: 4324
Ensembl: ENSG00000112164
Vega: OTTHUMG00000014638
Pharos: P43220(Tclin)
UniProt: P43220 A0A142FHB8
Structure
PDB: 

Position
6p21.2
AA seq 463 aa AA seqDB search
MAGAPGPLRLALLLLGMVGRAGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDL
FCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPW
RDLSECEESKRGERSSPEEQLLFLYIIYTVGYALSFSALVIASAILLGFRHLHCTRNYIH
LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLSCRLVFLLMQYCVAAN
YYWLLVEGVYLYTLLAFSVLSEQWIFRLYVSIGWGVPLLFVVPWGIVKYLYEDEGCWTRN
SNMNYWLIIRLPILFAIGVNFLIFVRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL
GTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQLEFRKSWERW
RLEHLHIQRDSSMKPLKCPTSSLSSGATAGSSMYTATCQASCS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggccggcgcccccggcccgctgcgccttgcgctgctgctgctcgggatggtgggcagg
gccggcccccgcccccagggtgccactgtgtccctctgggagacggtgcagaaatggcga
gaataccgacgccagtgccagcgctccctgactgaggatccacctcctgccacagacttg
ttctgcaaccggaccttcgatgaatacgcctgctggccagatggggagccaggctcgttc
gtgaatgtcagctgcccctggtacctgccctgggccagcagtgtgccgcagggccacgtg
taccggttctgcacagctgaaggcctctggctgcagaaggacaactccagcctgccctgg
agggacttgtcggagtgcgaggagtccaagcgaggggaaagaagctccccggaggagcag
ctcctgttcctctacatcatctacacggtgggctacgcactctccttctctgctctggtt
atcgcctctgcgatcctcctcggcttcagacacctgcactgcaccaggaactacatccac
ctgaacctgtttgcatccttcatcctgcgagcattgtccgtcttcatcaaggacgcagcc
ctgaagtggatgtatagcacagccgcccagcagcaccagtgggatgggctcctctcctac
caggactctctgagctgccgcctggtgtttctgctcatgcagtactgtgtggcggccaat
tactactggctcttggtggagggcgtgtacctgtacacactgctggccttctcggtctta
tctgagcaatggatcttcaggctctacgtgagcataggctggggtgttcccctgctgttt
gttgtcccctggggcattgtcaagtacctctatgaggacgagggctgctggaccaggaac
tccaacatgaactactggctcattatccggctgcccattctctttgccattggggtgaac
ttcctcatctttgttcgggtcatctgcatcgtggtatccaaactgaaggccaatctcatg
tgcaagacagacatcaaatgcagacttgccaagtccacgctgacactcatccccctgctg
gggactcatgaggtcatctttgcctttgtgatggacgagcacgcccgggggaccctgcgc
ttcatcaagctgtttacagagctctccttcacctccttccaggggctgatggtggccata
ttatactgctttgtcaacaatgaggtccagctggaatttcggaagagctgggagcgctgg
cggcttgagcacttgcacatccagagggacagcagcatgaagcccctcaagtgtcccacc
agcagcctgagcagtggagccacggcgggcagcagcatgtacacagccacttgccaggcc
tcctgcagctga

DBGET integrated database retrieval system