KEGG   Homo sapiens (human): 27429Help
Entry
27429             CDS       T01001                                 

Gene name
HTRA2, MGCA8, OMI, PARK13, PRSS25
Definition
(RefSeq) HtrA serine peptidase 2
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa05012  Parkinson disease
Disease
H00057  Parkinson disease
H00754  3-Methylglutaconic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    27429 (HTRA2)
   04215 Apoptosis - multiple species
    27429 (HTRA2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    27429 (HTRA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    27429 (HTRA2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    27429 (HTRA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     27429 (HTRA2)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   27429 (HTRA2)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  DegP / HtrA
   27429 (HTRA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ_2 PDZ Peptidase_S46 GRASP55_65 Tricorn_PDZ
Motif
Other DBs
NCBI-GeneID: 27429
NCBI-ProteinID: NP_037379
OMIM: 606441
HGNC: 14348
Ensembl: ENSG00000115317
Vega: OTTHUMG00000129957
Pharos: O43464(Tbio)
UniProt: O43464
Structure
PDB: 

Position
2p13.1
AA seq 458 aa AA seqDB search
MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWAR
LSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLL
LWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRR
YIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQM
VQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgccgagggcggggcggggtgcaggctggagccttcgggcatggcgggctttg
gggggcattcgctgggggaggagaccccgtttgacccctgacctccgggccctgctgacg
tcaggaacttctgacccccgggcccgagtgacttatgggacccccagtctctgggcccgg
ttgtctgttggggtcactgaaccccgagcatgcctgacgtctgggaccccgggtccccgg
gcacaactgactgcggtgaccccagataccaggacccgggaggcctcagagaactctgga
acccgttcgcgcgcgtggctggcggtggcgctgggcgctgggggggcagtgctgttgttg
ttgtggggcgggggtcggggtcctccggccgtcctcgccgccgtccctagcccgccgccc
gcttctccccggagtcagtacaacttcatcgcagatgtggtggagaagacagcacctgcc
gtggtctatatcgagatcctggaccggcaccctttcttgggccgcgaggtccctatctcg
aacggctcaggattcgtggtggctgccgatgggctcattgtcaccaacgcccatgtggtg
gctgatcggcgcagagtccgtgtgagactgctaagcggcgacacgtatgaggccgtggtc
acagctgtggatcccgtggcagacatcgcaacgctgaggattcagactaaggagcctctc
cccacgctgcctctgggacgctcagctgatgtccggcaaggggagtttgttgttgccatg
ggaagtccctttgcactgcagaacacgatcacatccggcattgttagctctgctcagcgt
ccagccagagacctgggactcccccaaaccaatgtggaatacattcaaactgatgcagct
attgattttggaaactctggaggtcccctggttaacctggatggggaggtgattggagtg
aacaccatgaaggtcacagctggaatctcctttgccatcccttctgatcgtcttcgagag
tttctgcatcgtggggaaaagaagaattcctcctccggaatcagtgggtcccagcggcgc
tacattggggtgatgatgctgaccctgagtcccagcatccttgctgaactacagcttcga
gaaccaagctttcccgatgttcagcatggtgtactcatccataaagtcatcctgggctcc
cctgcacaccgggctggtctgcggcctggtgatgtgattttggccattggggagcagatg
gtacaaaatgctgaagatgtttatgaagctgttcgaacccaatcccagttggcagtgcag
atccggcggggacgagaaacactgaccttatatgtgacccctgaggtcacagaatga

DBGET integrated database retrieval system